ELF>@|-@8@@@@,6,6060F0Fxx@@@P)+<+ȶ@@Rtdx@ Qtd-7L^p{ !.5N]q P(+<'+@ H$U w M fM f ^,20N:yj՗j##  !"  ijl_gc_pool_allocijl_get_nth_field_checkedijl_throwjl_boxed_uint8_cacheijl_apply_genericjl_f__call_latestjl_nothingjl_undefref_exceptionijl_type_errorjl_f__exprjl_falseijl_bounds_error_intsjl_truejl_f_tuplejl_f__apply_iteratejl_libjulia_internal_handleijl_load_and_lookupijl_copy_astmemsetijl_lazy_load_and_lookupjl_f_finalizerjulia__gnu_h2f_ieeejulia__gnu_f2h_ieeejulia__truncdfhf2jl_f_sizeofmemmoveijl_bounds_error_tuple_intijl_gc_queue_rootijl_invokejl_RTLD_DEFAULT_handle_pointerjl_RTLD_DEFAULT_handlejl_image_pointersjl_system_image_datajl_system_image_sizelibjulia.so.1.10JL_LIBJULIA_1.10libjulia-internal.so.1.10@H0PXЉ``hpxP0F0,LTPp ,P### !,(!,0 !,P8X` h0!,p#  ( 0,,,,,, , , , ,(,0,8,@,H,P,X,`,h,p,x,,,ijl_array_del_endijl_cstr_to_stringjl_n_threadsijl_operator_precedencememcmpSSL_CTX_newijl_alloc_stringSSL_CTX_load_verify_locationsijl_array_grow_endifijl_pchar_to_stringtypeassertjl_n_threads_per_poolstrlenijl_array_to_stringTLS_client_methodSSL_CTX_ctrlijl_alloc_array_1d !"#%&(+./123467;=?@BGHJKLMSUVYZ\]`bcd #$%'-059;<CDFIJKNPQUW[\^`acefhklnpqstvxyz{}~ !"$%&()*+,-./8@ABCEFGHQRSTUVYZ[\]^_`dgijlopsz{|3@p@`P0 `  @p@00 ``P5P5066<6@>0=>??`@pB B`hP h@8X 8HpH0 (P`@xpxp@0(((hpxP0HX`h8@h 08P`hH(hpx (08HPX`px(pxP`@HXH080p( 08@xXhxX XP`HP8 @`@_-$  $')*,-0589:<>ACDEFINOPQRTWX[^_a  !"&()*+,./1234678:=>?@ABEGHLMORSTVXYZ]_bdgijmoruw|     #'012345679:;<=>?DIJKLMNOPWXabcefhkmnqrtuvwxy}~2P @ p @ `@   ` 00pPPp&$-0'-6`. 7`7p88XP@@Hp0h @H(8`8x`H0X P0p8 PXH  (px (0@HPX`hpxh`08@HPX`h8 HPX`hpxp(08@x0 8(HXhpxh8@((Px` v) _@: Aa ! 0generic<'+zRx ,!nAC K A L%AC E$l%CAC C{ $%AC I `&AC N `& AC [ `&<AC Fq &CAC ~ $<&<AC Ct ,d&AC I A ,x'AC I A ((AC $(QAC CI $ (<AC Ct $4)AC E $\)AC G A $x-YAC CQ -@AC Ev -<AC Fq -<AC Fq $ .AC G $4.AC K \/<AC Fq $|/#AC K $0AC I ,@1AC K A ,2AC I A ,,2AC I A $\`5<AC Ct $x5<AC Ct $5AC K $h6;AC Cs $6AC I $$7AC Kv Lp7AC S $lp7AC I $8AC z A $pQ*AC V A $xQAC I  RFAC F{ $,0R<AC Ct ,THR(AC K= A $HX<AC Ct $`XAC K HY<AC Fq $hYAC K PZ<AC Fq <pZAC  ,\ZAC Ke A p\CAC ~ $\<AC Ct $\KBAA BAB\IAZBj]IAZBj<@]IAZBj\p] AKth] AK`] AKX] AKP] AK,@]AC M A , aAC MA A ,< 0dAC M A $l hKAC CC $ h.AC V A $ hAC I $ XiAC K   Pj<AC Fq $, pj'AC S A $T xjAC I ,| kAC I A , kAC I A , `lAC I A  mAC O $, mAC I $T m<AC Ct ,| meAC M A , nVAC I A $ p<AC Ct  8p<AC Fq $ Xp@AC Ev D xp@AC Ev d p<AC Fq , pAC I A $ hqAC K $ rAC K  rFAC F{ $$ (sAC E L sCAC ~ $l s<AC Ct  sCAC ~ $ (tAC Kq $ tAC K $huSAC GG $,uAC I T8v+AC f $tHvAC K  w<AC Fq ,@wAC P_ A ,{EAC I A }FAC F{ ,<~KAC M A l0FAC F{ `AC  ,ЄrAC N A $ <AC Ct 8<AC Fq $$XAC K $L@<AC Ct $tX@AC Cx pIAZBj$KBAA BAB$ȎKBAA BAB$ KBAA BAB,4PBBA EBBd8 AK|0 AK( AK AK AKUHAWAVATSHpMHUHuW)E)EHEIEHEHEIEIEH@HAE1HY+HEH}HfDрt'HHHHptHH0IHrtMwI}P0Z~HMHHHMHHMHHHMHHMԈHM͋UЉHPHEHL*~IHHHHP€ʀMHM+IH+HEH+HEAAH E+HxH]u8Lu UHpHHELUIs<pHCHHpt:H=VHsHLuH]LUIs=fffff.HH LuHLHHUII\$I}P0|HxHHHMHHMHHHMHHMԈHM͋UЉHPHEHH|HIH@HH=P IIvHCH9}H)xnH3H]HtHxbH)xjH =H]HHHH]HHMIMHp[A\A^A_]H=+|H=+{H=e+G+H=X+"+H=K+H*+fUHSH8W)EHEHEIEHEHEIEIEH@HH.+H w+Hx+HH4HMH}HUHuH]HH޺DH=H+HEHEH޺C{H=4+HEHEH޺'{H{ffffff.UHAUSHH+HtdH %L, t+IH;HC0[A]]ffff.UHAVAUSHHHEW)H@H7+HtdH %L,  +IHEIEHEHEIEH8KAH+H]I}zHXD0HMIMH[A]A^]ff.UHIMHIH ]ffff.UHIEH@HH=+1œ]UHAUHH_+HtdH %L, 4+IHA]]@UHH IEH@HHf+H +HEHMH}Hu1cyH ]ffff.UHAUSHH+HtdH %L, +IH;y[A]]@UHAWAVSH8AHW)EHEHuHs+HdH %L4HEIHEHEIIFH@HH=+AHHDxHHPHH+Ht+H9t#H=+HMHEHMHuExHHMIH8[A^A_]+IcUHAWAVSH8AHW)EHEHuH+HdH %L4HEIHEHEIIFH@HH=+AHHDwHHPHH+Ht+H9t#H=+HMHEHMHuewHHMIH8[A^A_]+IcUHH0W)EHEHEIEHEHEIEIEH@HHHxuHH8vHHHuHsH8vH=+HEHEHuغvH5+H8HHuH=vDUHAUSHH+HtdH %L, +IH;HsHCHHCHGNH[A]]ffffff.UHAUSHH+HtdH %L, +IH;iO[A]]@UHSH8W)EHEHEIEHEHEIEIEH@HH+HEH}H]1H޺uH T+H+H5+HEHMHUHuHE1H޺uHMIMH8[]fff.UHAVSH0W)EHEHEIEHEHEIEIEH@HHH;+t1tHHGHx,HHHdH=+HEHELuLtH=+HEHELtH=+H 5+HEHEHMLltHHHHH H;H{HGHHHIHL5v+HQHI9H=+Ho+HMHMHEHusHHHH9 +t0H9 +H;@+<u-161/1(H5+HEHp+<tH{HGH|HHHHHQHI9H="+H+HMHMHEHu1sHHHH9 +t"H9 +H;+<u1H5w+HEH+<tH{HhHH8HH+H9tHGHHpt E1)H~H}HLcHHdHI9HMIMHe[A^]HH8LrH5+HuH=YHbrHH)H9}H4$HH9|HHMrHH8qHH)H9}H4$HH9|HH rHZH8qHKH8qH5+H%+HuH=qH5+H+HuH=qHH)H9}H4$HH9|HHzqf.UHAUSHH+HtdH %L, +IH;H H HHHEH[A]]UHSHIEH@HHE+I}rpHXHH[]UHAUHH+HtdH %L, +IKHA]]@UHAUHH+HtdH %L, +IKHA]]@UHAVSH W)EHEHEIEHEHEIEIEH@HH=̽+ HL5O+HEI}  poLpHHW@HMIMH [A^]f.UHAWAVATSH0HuHEW)E)EHEIEHEHEIEIEH@HL54+I}  nHLpWHL0L3LsL=+H]I}nILxHL=+HEI}@ynLxHW@L0 H@ HXL`HMHUH HBHEIEH0[A\A^A_]ff.UHAUHH+HtdH %L, +IKHA]]@UHAWAVATSH0HEW)E)EHEIEHEHEIEIEH@HHػ+I}  mIHXWH1L0M4$Mt$H+LeI}GmIHXHH+HEL}I}@mHHEHCHWCL3!CC LcL{H]JHMHHAHEIEH0[A\A^A_]ffff.UHAVAUSH(HEW)@)H@ H]HHN+HtdH %L, #+IHE IEHEHEIEH`L51+LuI}  "lLpH HHKHHHMIMH([A]A^]ffff.UHAWAVATSHPAIW)E)EHuH+HdH %HHEHHEHEH1LD lIHCH@LeHH=+LDkHEHELu1LkH N+H+HEHMHUHELe1LkHMH HP[A\A^A_]+HKf.UHAWAVSH8AHW)EHEHuH+HdH %L4HEIHEHEIIFH@HH=Ϳ+AHHDjHHPHH+Ht+H9t#H=߷+HMHEHMHuejHHMIH8[A^A_]+IcUHAWAVSHIEH@HH+HuH5H|tjH+D8McHؿ+HsHˌHsL9}LH)HHtEL)HH+HsHwHsL9}LH);HH.tE|L)H7H+HsH#HsL9}LH)HHڋtEBL)FHH\+HsHϋHsL9}LH)HHtEL) HH+HsH{HsL9}I)xvHL9tEL)HBH[A^A_]H=+H+H=+Hw+H=+Hg+H=x+HW+H=h+LG+H=X+"+H=K+-+H=>++H=1++H=$++H=++H= ++H=+ߺ+H=++H=+ź+ffff.UHAUSHH+HtdH %L, +IH;YF[A]]@UHAUSHH+HtdH %L, +IH;YG[A]]@UHAWAVAUSH0IHEW)@ )@)L}IH]+HtdH %L, 2+IHEIEHEHEIE HH)H9}H4$HHI6IVINHLGL5+LuI}P0fLpH HHKHHHKHHHKHHHMIMHe[A]A^A_]ff.UHAVSIIEH@HHd+I}eHXL0[A^]DUHAVAUSH(HHEW)@)H++HtdH %L, +IHEIEHEHEIEH;]IHK+LuH]I}dHXL0HMIMH([A]A^]fffff.UHAWAVATSH MHUHIMIIEH@HH\+HEI}dHMHHHMH HM'IGMwLsM܈KHCL#H [A\A^A_]f.UHIMHIH H8Hp]UHAVAUSH(IHEW)@)H@ H]HH+HtdH %L, +IHE IEHEHEIEI>IvHfL57+LuI}  cLpH HHKHHHMIMH([A]A^]UHIEH@HH=+_HHHQH5+H1fDH4HH9uHc)H5c+HHdIH5ñ+H HeiH5+H(HfH5+H0HH5+H8HH5}+H@HH5j+HHHH5W+HPH H5D+HXH7 H5+H`HT H5+HhHq H5+HpH H5+HxH H5}+HH+ H5j+HX H, H5W+H` H- H5D+Hh H. H51+Hp H/< H5+Hx H0Y H5 +H H2v H5+H H3 H5M+H H H5ʷ+Hx H H5+H H H5+H H H5 +H H$ H5v+H HA H5c+H H^ H5P+H H{ H5=+H H H52+H H H5+H H H5 +H H H5+H H H5+H H) H5۶+H HF H5ȶ+H Hc H5+H H H5+H H H5+H H H5|+H H H5i+H H H5+H( H H5+H0 H. H5+H8 HK H5+H@ Hh H5 +HH H H5W+HX H H5D+H` H H51+Hp H H5+H H H5+H HH5+HH3H5+HpHPH5ڭ+HxHmH5ǭ+HHH5+HHH5+HHH5+HHH5 +HHH5+HHH5+HH8H5Ҵ+HHUH5Ǵ+HHrH5+HHH5+HHH5+HHH5+HHH5Ь+HHH5+H8H H5+H@H =H5+HHH ZH5+HPH wH5q+HXH H5^+H`H H5+HhHH5г+HpHH +HH]HH)H9}H4$HH9|HHdH[HH)H9}H4$HH9|HHeHZHH)H9}H4$HH9|HHfHZHH)H9}H4$HH9|HHgHqZHH)H9}H4$HH9|HHH9ZHH)H9}H4$HH9|HHHZHH)H9}H4$HH9|HHHYHH)H9}H4$HH9|HHHYHH)H9}H4$HH9|HHHYYHH)H9}H4$HH9|HHH!YHH)H9}H4$HH9|HHHXHH)H9}H4$HH9|HHHXHH)H9}H4$HH9|HHHyXHH)H9}H4$HH9|HHHAXHH)H9}H4$HH9|HH,H XHH)H9}H4$HH9|HH-HWHH)H9}H4$HH9|HH.HWHH)H9}H4$HH9|HH/HaWHH)H9}H4$HH9|HH0H)WHH)H9}H4$HH9|HH1HVHH)H9}H4$HH9|HH3HVHH)H9}H4$HH9|HH4HVHH)H9}H4$HH9|HHHIVHH)H9}H4$HH9|HHHVHH)H9}H4$HH9|HHHUHH)H9}H4$HH9|HHHUHH)H9}H4$HH9|HHHiUHH)H9}H4$HH9|HHH1UHH)H9}H4$HH9|HHHTHH)H9}H4$HH9|HHHTHH)H9}H4$HH9|HHHTHH)H9}H4$HH9|HHHQTHH)H9}H4$HH9|HHHTHH)H9}H4$HH9|HHHSHH)H9}H4$HH9|HHHSHH)H9}H4$HH9|HHHqSHH)H9}H4$HH9|HHH9SHH)H9}H4$HH9|HHHSHH)H9}H4$HH9|HHHRHH)H9}H4$HH9|HHHRHH)H9}H4$HH9|HHHYRHH)H9}H4$HH9|HHH!RHH)H9}H4$HH9|HHHQHH)H9}H4$HH9|HHHQHH)H9}H4$HH9|HHHyQHH)H9}H4$HH9|HHHAQHH)H9}H4$HH9|HHH QHH)H9}H4$HH9|HHHPHH)H9}H4$HH9|HHHPHH)H9}H4$HH9|HHHaPHH)H9}H4$HH9|HHH)PHH)H9}H4$HH9|HHHOHH)H9}H4$HH9|HHHOHH)H9}H4$HH9|HHHOHH)H9}H4$HH9|HHHIOHH)H9}H4$HH9|HHHOHH)H9}H4$HH9|HHHNHH)H9}H4$HH9|HHHNHH)H9}H4$HH9|HHHiNHH)H9}H4$HH9|HHH1NHH)H9}H4$HH9|HHHMHH)H9}H4$HH9|HHHMHH)H9}H4$HH9|HHHMHH)H9}H4$HH9|HHHQMHH)H9}H4$HH9|HHHMHH)H9}H4$HH9|HHHLHH)H9}H4$HH9|HHHLHH)H9}H4$HH9|HHHqLHH)H9}H4$HH9|HHH9LHH)H9}H4$HH9|HHHLHH)H9}H4$HH9|HH HKHH)H9}H4$HH9|HH HKHH)H9}H4$HH9|HH HYKHH)H9}H4$HH9|HH H!KHH)H9}H4$HH9|HH HJHH)H9}H4$HH9|HHHJHH)H9}H4$HH9|HHHyJHH)H9}H4$HH9|HHHAJUHIMHIH Hr]H=++fDUHAVAUSHHHEW)H@HG+HtdH %L, +IHEIEHEHEIEH8gAHe+H]I}IHXD0HMIMH[A]A^]fff.UHAUHH+HtdH %L, +I-Hu[HHA]]f.UHAUSHH_+HtdH %L, 4+IH;Y;[A]]@UHAWAVATSHpIW)E)EHEHE IEHEHEIEIEH@HHkHH=D+L=+HEH1AH ZL!L9tYHxH[HHHHHHH9 P+H=#+HEH}HEHuGH=ݙ+H1AL9HxH)HHHOHHHH9 ړ+mH=+HEH}HEHuCGlHHxHHHpHjHMHEH5HH+IH=+HEhGHH=+HEUGH +H+HEHMH]HELuHUHu1FBL;5s+JL;5n+KL;5i+LL;5+HL;5+IH=b+L;5S+CI9L;5+L;5@+L;5+aL;5V+oH=+|FHHxHH HpHhHMHEH5HHԗ+IH=+HE!FHH=ϗ+HEFH O+HP+HEHMH]HELuHUHu1EHMIMHe[A\A^A_]H=|+EH=v+EH+H=+EH= +EmHEH=Z+HEYIH=+HEFIH<+H+HpHמ+HxL5!+LeI}P0bDLpHMHHXLxHXHEHpHMHxHMHELeHu1DH=+DH=+DH=C+DIH=+HEDHL=)+H+HEL%+H]I}P0CL`L8LpHMHHHX\H=+(DKHH)H9}H4$HH9|HHCHUH8OCHH)H9}H4$HH9|HHjCHUH8 CH=D+HM+HL5+HEI}BLpHHBH=+HMY+HL5+HEI}xBLpHHBH=z+Hۜ+HELuHuHEH+UHAUSHH+HtdH %L, ĝ+IH;[A]]@UHAWAVATSH0W)E)EHEHE IEHEHEIEIEH@HH=+dHH8HP1HBH=+HdH]IH=͔+H~dLuȾIL%q+HEI}P2AL`WH@HLpLx@H@(H "HH0H@8HMIMH0[A\A^A_]ÐUHAUHH+HtdH %L, t+IHA]]@UHAWAVATSH0W)E)EHEHE IEHEHEIEIEH@HH=<+icHH8HP1@H=Q+HJcH]IH=+H.cLuȾIL%)+HEI}P?L`WH@HLpLx@H@(H ҔHH0H@8HMIMH0[A\A^A_]ÐUHAUHHO+HtdH %L, $+I;HA]]@UHH0W)EHEHEIEHEHEIEIEH@HH='+H+H !+HEHMHuк H=Ę+H+HEH+HMIMH0]fUHAWAVATSH0IW)E)EHEIEHEHEIEIEH@HHH +Hu$H2+H8H}H5M'?HHݑ+HHHL=}+I}">ILxHH+LeHELeHu1>M<$HJ+Hu$H+H8H}H5t>HH!+L!1I>tGIM<$H +Hu$HW+H8H}H5L>HHژ+LL1уu0HEIELH0[A\A^A_]H=̖+11k=HS=H=Ԑ+H+HEHuC=H+=ff.UHH IEH@HH+H _+HEHMH}Hu1=H ]ffff.UHAUSHHo+HtdH %L, D+IH;y[A]]@AVSPIHH+HuH5H,O<H˗+H$_HLH[A^DSHH+Ht H_H[H5HN<H+H^H[SHH+Ht H^H[H5*HN;<Hd+H^H[SHHM+Ht Hq^H[H5ӆH5N;H+HE^H[Pf<XPf<XP <fXP;fXP;fXUHAWAVAUATSHXAW)E)EHuH+HHudH %HHEHHMHMHHHHIH DEHMHEZHL5+LiA1ۉuED ɸ@Hwnfffff.<3HBHH=t8I9HpHU1Hu:HuHHM9u\Hffff.HM9tDJTIHBHH= o*f.HBHM9uHH +H@H1IELEH}IH+HEHAAH}ȉffffff.=HƉfDHɁwfCD,AH:CT, AH HCD, I ffff.<HCHH=txH9EHpLeH]1Hu<9HH|IHK<,HH)9M?LEH}fCD,AsH9Et*L;HK<,HHL8H}LEFfDL{MHHKH4HK<,HL8LEH}fff.I9t1MK\IHCHH= JHEHMHLHX[A\A]A^A_]1H +HH5HI7HH++Hu)H5+HuH= 6H5+HuH=H6H=+H]LmH+H=+H]LeLmL؉+H=+LmHĉ+fff.UHAWAVAUATSHXAHW)EHEHuHߑ+HdH %L,HEIEHEHEIEIEH@HEFH]HH='+HEHu5L8EDuAtNL5+ID$HEI9HEHHELHu5L8HI9uLeHM+HLuIH=+H]H]HEHu.5}LmL5+HEHHHAHMLMLxIE1@M9HEJDH]HELHu4IM9uLm%HE1U+HL3HsIFH9}H)H2WLuL#t!HxH)H 8WLuLHH WLuLHMIMHX[A\A]A^A_]+IH}LHU5H}HuHU4H=G+)+H=:++H=-+H +@UHAWAVAUATSHXAW)E)EHuH6+HHudH %HHEHHMHMHHHHIH DEHMHEZHL5+LiA1ۉuED ɸ@Hwnfffff.<3HBHH=t8I9HpHU1Hu3HuHHM9u\Hffff.HM9tDJTIHBHH= o*f.HBHM9uHH +H@H1IELEH}IHf~+HEHAAH}ȉffffff.=HƉfDHɁwfCD,AH:CT, AH HCD, I ffff.<HCHH=txH9EHpLeH]1Hu1HH|IHK<,HH1M?LEH}fCD,AsH9Et*L;HK<,HHL1H}LEFfDL{MHHKH4HK<,HLT1LEH}fff.I9t1MK\IHCHH= JHEHMHLHX[A\A]A^A_]1H l+HH5zH}B30HHA+>+Hu)H5+HuH=z/H5+HuH=zH/H={+H]LmH+H={+H]LeLmL+H={+LmHt+fff.UHAUSHH+HtdH %L, +IH;HsHSHC芯[A]]DUHIEH@H$<s]H{+@H²fUHAVAUSHHHEW)H@H+HtdH %L, +IHEIEHEHEIEH8'AH݂+H]I}-HXD0HMIMH[A]A^]fff.UHAWAVATSH@W)E)EHEIEHEHEIEIEH@HHz+L%e+HELeLu1L-Hz+HEH]HE1L-IHEH]Le1Lz-H +Hdz+HEHMHUHE1LM-H +H+HEHML}HEHU1L-HMIMH@[A\A^A_]UHAUHH_+HtdH %L, 4+IHA]]@UHIMHIH w]H=y+}+fUHAVAUSHHHEW)H@Hׇ+HtdH %L, +IHEIEHEHEIEH8gAH+H]I}+HXD0HMIMH[A]A^]fff.UHAWAVSH8AHW)EHEHuH#+HdH %L4HEIHEHEIIFH@HH=]+AHHD3+HHPHHyx+Ht+H9t#H=ox+HMHEHMHu*HHMIH8[A^A_]h+IcUHAWAVSH8AHW)EHEHuHC+HdH %L4HEIHEHEIIFH@HH=}+AHHDS*HHPHHw+Ht+H9t#H=w+HMHEHMHu*HHMIH8[A^A_]+IcUHAWAVSH8AHW)EHEHuHc+HdH %L4HEIHEHEIIFH@HH=~+AHHDs)HHPHHv+Ht+H9t#H=v+HMHEHMHu5)HHMIH8[A^A_]+IcUHHIMHIH ]fff.UHAVAUSH(HIHEW)@)Hh+HtdH %L, =+IHEIEHEHEIEHsLvIHu+LuH]I}1(HXL0HMIMH([A]A^]UHAUSHHσ+HtdH %L, +IH;ɰ[A]]@UHAWAVAUATSH8IW)EHEHEIEHEHEIELmIEH@HL.HAI;EslIIEHDHHL%|+HEHEHuLq'ANLuI~(IHDHOuH@t#M9}w6HEHMHLH8[A\A]A^A_];(M9}v HM;}sIEJHtPHEHELHuк&ANLuI~(IIHHOuH@u'H;9H8&ff.UHAWAVSH(W)EHEHEIEHEHEIEIEH@HHHXHHHHIH=X{+HEHEHuȺ&IH=s+HHL}HHHxt|CHߨuH{(HL8HGШuIGt=H]HLH=+s+1HHMIMHe[A^A_]&H8H8b%HH)H9}H4$HH9|HHHz%f.UHAUSHH+HtdH %L, +IH; [A]]@UHAUHH+HtdH %L, T+IHA]]@UHSHIEH@HHr+I}R$HXHH[]UHSHIEH@HHMr+I}$HXHH[]UHAUHH+HtdH %L, +IHA]]@UHAWAVSH8AHW)EHEHuHc+HdH %L4HEIHEHEIIFH@HH=x+AHHDs#HHPHHiq+Ht+H9t#H=p+HMHEHMHu5#HHMIH8[A^A_]~+IcUHAWAVAUSH0IIHEW)@)H@ H]HHv~+HtdH %L, K~+IHE IEHEHEIEI7HL"L5+x+LuI}  D"LpH HHKHHHMIMH0[A]A^A_]ffff.UHAWAVATSH0W)E)EHEHE IEHEHEIEIEH@HH=w+DHH8HP1h"H=o+HDH]IH=uw+HDLuȾIL%o+HEI}PR!L`WH@HLpLxH FvHHHH HH(H@0HH8HMIMH0[A\A^A_]ÐUHAUHH|+HtdH %L, |+I輶H3HHA]]f.UHSH8W)EHEHEIEHEHEIEIEH@HHm+HEH}H]1H޺ H Du+H n+H5u+HEHMHUHuHE1H޺{ HMIMH8[]fff.UHH IEH@HHu+H n+HEHMH}Hu1 H ]ffff.UHAUSHHo{+HtdH %L, D{+IH;y[A]]@UHH IEH@HHvt+H n+HEHMH}Hu1sH ]ffff.UHAWAVATSHIHUHIIIEH@HHm+HEI}HMHHHMH HM&IFM~L{HCL#CH[A\A^A_]ffffff.UHAWAVAUSH0IHEW)@ )@)LuIH-z+HtdH %L, z+IHEIEHEHEIE HH)H9}H4$HHI7IWIGMGHLL5jk+LuI}P0LpH HHKHHHKHHHKHHHMIMHe[A]A^A_]@UHAWAVATSIIHIEH@HL%*l+I}WL`IHHLs[A\A^A_]ffff.UHAVAUSH(IHEW)@)H@ H]HHx+HtdH %L, x+IHE IEHEHEIEI>IvH&L5Gj+LuI}  LpH HHKHHHMIMH([A]A^]UHMEM@MH7HWHOHHHPH0@]DUHAWAVAUSH0IHEW)@ )@)L}IHw+HtdH %L, w+IHEIEHEHEIE HH)H9}H4$HHI6IVINHL0L5!i+LuI}P0LpH HHKHHHKHHHKHHHMIMHe[A]A^A_]ff.UHAUHHv+HtdH %L, v+I謷HA]]@UHAWAVAUATSHMW)`)E)E)pHEHDž`IEHhH`IEIEH@HL5us+Hk+LHMLHH^=H Os+HEHHxHHDžƅH=dHMs+HxjIHL0ML}HHHH}k+H5~k+HHH5Hk+HPH5Bk+HXHuȾHuH5*k+HuHH@HUHL9HK<>HH<LeLuH@ЅLuLL H(LmHHHLuLLHHHPHHHLHr H9LIHHpLmLLXLLHMIH;MLeLuLHIHO;LuH]HЋCHߨuH{(HCH LtHGШL}H]uIFtdI;]siMIEH}L48MHuHNHIH HHHHHuHH}HH]HL9H8#I;]rHhIH[A\A]A^A_]H=h+LuLm7r+HL5d+HEI}VLpHHgH*H8XHIp+HEHFp+HEHc+HELuLmI}  HMIHEID$M4$M|$I\$L5_h+LeI}  LpHHMHHHEL0H8H0H}HMHMLVo+H/)H8ffffff.UHAWAVSHIEH@HHi+HuH5`H(Hi+D8McH8o+HsH 9HsL9}LH)+HH8tERL)VH8Hn+HsH8HsL9}LH)HHn8tEL)Hw8Hg+HsHc8HsL9}LH)HH8tEL)H#8Hf+HsH8HsL9}I)xfHL7tEL)H7H[A^A_]H=LL!7LH=f+11 H DUHAUHHi+HtdH %L, h+I|HHHA]]f.UHH0W)EHEHEIEHEHEIEIEH@HH=^+Hf+H ^+HEHMHuкH=f+H^+HEHg+HMIMH0]fUHAWAVATSHIW)p)E)EHDžpIEHxHpIEIEH@HHa+H _+Hf+HEHMHPHUHu1U L5f+HEHELAHH^+H`Hf+H H^+HXHVf+HEH^+HEH`f+HHZf+HHTf+HH^+HH`+HH2f+H0HTf+HH6f+HH(a+H8H"f+H@H\^+HHAHe+HHLhfDLuH]I} HHHHHHEH8HMH@HMHELu1Hu M?LHII9H&HH5q_LL`рHHH3I9\ҹHIHMHIHEHHML MwI9LNLeM9H(MLhM;4$LLHXӨLLLLUHL)H )e+Hu"H5]TH9 HHe+H1IHhJ48HI|$HT H(H,LeLLIFANLuI~(ILdHGШu ID$oH3LhLUHHHELHHLHHEH1IHEHwIIFHH9uH0I9L}HpLuHHuLIIFHH=s H c+HHMHYHH9H*LuH]HCHߨuH{(HCH LtHGШ-IF!fff.LIIFHH=cSLAHMHYMwI9LNM9MM;4$H`H]LLHXӨLLӨLLUIM)H`H b+Hu"H5QHKHHYb+L1K4S+HwX+LuLuHEH]H޺JH=S+H _+HEHEHMH޺#HHHHuH=_+HEHEHuHLLW+W+H=4Q+HX+H]+HEH]+HEHV+I}  kHXL8LpHELeHEHuH}кHMHVLLJW+LL>W+H=P+LW+fffff.UHAUSHH_+HtdH %L, _+IH;I[A]]@UHAUHH_+HtdH %L, T_+IHA]]@UHAWAVATSH0W)E)EHEHE IEHEHEIEIEH@HH=Y+I&HH8HP1H=1^+H*&H]IH=-^+H&LuȾIL%YV+HEI}PL`WH@HLpLxH WHHHH HH(H@0HH8HMIMH0[A\A^A_]ÐUHAUSHH/^+HtdH %L, ^+IH;[A]]@UHAUSHH]+HtdH %L, ]+IH;Hs5[A]]SHHU+Ht H$H[H5LH[HlU+H$H[AVSPIHH]+HuH5#LH\H\+H|$HLH[A^DAVSPIHHU+HuH5LH HT+H4$HLH[A^DAVSPIHH\+HuH5%LHrHs\+H#HLH[A^DAWAVSIIHHK\+HuH5yKHhH'\+H#HLL[A^A_PfEXPf5XP:fXP*fXP*fX5K+%K+@%K+h%zK+h%rK+h%jK+h%bK+h%ZK+h%RK+h%JK+hp%BK+h`%:K+h P%2K+h @%*K+h 0%"K+h %K+h %K+h% K+h%K+h%J+h%J+h%J+h%J+h%J+h%J+hUw  o# (,  ooHooejli  Linuxx86_641.10.3v1.10.30b4590a5507d3f3046e5bafc007cacbbfc9b310b <'+CoremуJ5Basemу]J5MainmуJ5ArgToolsBń x(mуF K5 Artifactsmr-V3|mу K5Base64UlD*_mу> K5CRC32c\y.jmуj K5 FileWatchingXzsy`{,zmуh& K5LibdluVW59˗,mу-" K5LoggingT{VhUXM=mуrU" K5MmapP~:xg,Omу|' K5NetworkOptionsC0YW,mуʠ, K5SHAQ<$!<%mу1 K5 Serialization [)*k1mу-G K5Sockets1V$ bdސݗmуYBY K5UnicodeP>I>Nrmуeszo K5 LinearAlgebraSm7̏mуuux K5 OpenBLAS_jll[(Śb6EcQ FmуDux K5libblastrampoline_jllLSۆ }lxӠmу^} K5MarkdownZPn7z`smу/Ed~ K5Printfg^cX׸QDmу;h K5Random_ɢ?\Ymу? K5TarOi>աmу!t, K5DatesEY8pj2 mуX K5FuturebS;3{I xVMmуsD K5InteractiveUtilsWL ~@'ZmуVg K5LibGit2Z[&RPTv3EКRmу8J K5 LibGit2_jll YXg}]$mуD K5 MbedTLS_jllAX 3ȡ_mу- K5 LibSSH2_jlloTZk)߆#V"\"6TranscodingStreams(P;BŦ&߸Y07TestExtRm()Dy~W 97Zlib_jll?QXZwzTחNUO5 CodecZlibZ\xfK1Sj=8SimpleBufferStreamKTzw8P"\(-6$&f. o #v@f. 1.vv:2v&f. }}=vv\S@qj 60f. _;'vvv9`Hة2Ycf.`` ԄvvH@f. hvv3 0&f. {0vvFYf.   /ذvv08P0vi+ةf." q]vvv9)ľ)&f.& p38vvJ)v8)0f)000`* M/Fr0.g]`/P0f.- 'ǁvv/ vTjBTjv*vx::v>`01vv`0 1J7U00f.  1 qvvP7PjU70f.5 =jvvU74H70f.0 0 9 TnxvvH7P vF//vn8.vG) @ p@`0p@0 0@P `0pp@~P~}`}|`|0|@{{yyxx`w0wpv@vu`utpts`srprq`qnPnpm@m@llPk kiPih`hePe`d0dPc cpb@ba``_^^]]\p\[P[Z`Z 0ZpY@YXW WVTSRRQ`QPpPOONNMMpL@L`K0KpJ@JIPI@0HGDC@p@`@@P? ?@>>P= =<;0;;:988776655443`3P2 2`1011P0 0/,P,+**@*`p)((P(p'@'&%$$4-$z-P$(c $6'#ƴ7#7#7`#M0#1#n1"1"|`p">~w@"w"{!9!&,!$V+P!ڸ( !( ( ^V] ps`  !0  x 0y#gpF@~F>$!P,7XgCP>2  4~4G7l7`,;50 V5'5|4fp-@478E/88Ph# ##r0i.q,`,0,bp0o0t,p>@zzP""$$Pb& &k.j.0`0##D/"8\p,"@nX>H!!4\PP &&'JD`.M0&(Y5X5X5p1@41L1&&7Pb( @&0ԑ0((`00J&+س71+pdD@FF(U<&P& $@(0&z`#0b02P & |&p &@ "N. j5 h5 |) *P F .F * 1 B1` I-0 I- 7 ( Z)p *@ 4* ҿ1 1 y! y!P `y! 00+0+-`-0B,",@MT`pR7@77HP P  z Z ))`*011vb5^5p"U<@+X *&%0PRP 6'#+#+(`D0i!n!( t!p0@f0F)M4'',P', `',1ν11`0P0rPt1+p$1+@,,X,8,zVPԩn r-l*Di!`n!0t!y!y!MpL-@f1x-?j?rDP 7 7)6)*`*0:11p'jn'p?@X ,,, ,`P\2 3  `S+0X 6 n)-~(-pV(-@ C/>dRޒP R3a8`0f0223<<p<@<<KM|_P( (R3a,"`V."0"/"DEhEz.p8o'@np'xy?P`p`0L>Tpb@ka2Px H *@J`n00lQ0..p,F%@*,**FFP* 11,,`*0**ξ11pж,@,Q,&&b[IPB[I W'LX''`Q0'6<#.p}H@}H''r=5PQ5 D`727RE`xE0 EE0"pg@^%8%8 8?JQPP<] Gl[@ '`D077j7pφ@?EJE@FgP5 55+?z?`ކ?0HOOzU1W1pfW1@P1?RS1T1P) MI D%B%`)0*@*p22p^2@ܣ3mUmUZ'P['PV\' v__>T%T%`&0&%'Z8spo@Tjk'k':7:cP3 ,3R6N'(n`0UR, c>KphR@ zan   Pr" $Z$#(`t"08*O*k*~-p@@Dpk*;5Q5rg5Ph0 "&"4"`#0j&>70p1@61v1l_+$_PH_ $!l!*V+`S]0X8F:cp~C[@D`SP_P t!s!>x!x!`w!0w!*l*1p1@BN-N-M'61P4' bt!Bt!''`0)0 )v*f11p>7@λ)*@*11Pw! && &&&`D&0p&Z1н&`&pB0@:PD&&&^K.PZf5 e5)7r-`R)06'"/+кH (p*@Di!m!P (H}5PDy  f+^*0*`101e5зd5\*p:*@**21v1w!Pv! p% ^!rm!jA`*&0#l#д"0cSp<^@X.+3,3,3,P3, t3,T3,8ƭ7`70H2,(2,б2,1,p1,@2,*T<* P7 .__  `` 0@ @y!Ю y!μ&p,@1&HH>*PDD * `# 0y!x!Ыx!x!p&@x1&~7w!zw!PZw! :w!**f1`10M1ШnLp&@ ΰ EE'Pf, f,f,f,~f,`^f,0}5 E[Хt!pt!@''*J&&PJ& ~x!^x!`(jA0l&#Т*  p! @700 P  E.E(,`,0:,,П,,pDO.@x.Dl""^'P*m gRD'cXb6`x0LaH1cМ23p0c@l2b31c23P8? n:?J7?d`1c`2031cЙB2^3p"g@<52FnfQ4kPt 8> 9cV`*0E'ЖcJmap9c@|:cH9?:?:c:cP(o t4@@>])`X)0T\J\)Г\)-p-@`-Bt%,.z>p8Pn" "ʚ  t`ę 0J#(R5АR5Q5p0#@xp&@5+4"TXlPnj T*zO)Gl2`30?ЊZPsp>@h',G/LG/G/#P15 &nY@t?`p?0֘nkkЇ-2*p,n@""""4#" "V'PDi' b'QQڷ``}50|5|5Єn{5REpE@<>0jZ@ʗ@P}j Qs-`0-0QnЁ6V)pfV)@--QDGlV}jPQ UsnnT)}j`0Ql~$Q~"Qp~ !@~82~ !} !}b)}^>P}YS }|m|%?|%?|h`|0|2|3{69c{:}p{j`S@{mc{C!zHz(z%PzX z!yd y! yz! `yB70yv!yv!xv!xxv!pxp&@x1x%wF wZ wXEPw|E w v82vt>v`t`v.20v3v2nu>Su"puO@u4tu^<tܳ8tn9tl<PtjO tsSFs&$.s@`sL.0sA.s?r?rzhpr8c@r> rf*?qF*?q2-qsPqn qD8pp'pf8`pN'0psp*?oP-o\P-po >@o>o n>n>C2nd3Pn' n|5mmmZ`ms0m8cmQl lNRplk@lp?]l4kmkQ"k!PkB@ k!jEjEj*E`jZE0jEj Hi* HiEpiE@ipEi Hh HhGhHPhH hGgHg:Hg7`g70g!g!fm f@pfܭ!@fEfHeEeHer8Pe8 e!d!dhd!`dF>0d/yd!c}>c)ypc@czcZb:bbPbڕ ba =aFa&`a0aCaL`P>!`7p`6@`L `<_&8_3+_(?P_P _#^ԣ8^^`^D0^D^D]3+]hnp] H@]{]|\0\$>\d P\". \b4[C[|z[ z`[z0[T*P[r2ZF2Z3pZ2@Z2Z3YHO)Y~jY2PYD3 Y T)XnX 3X3`Xh)0XtX3W*3Wa?pW _)@W^)W^)VBOV2OV.mPV- V-U-U`-UE`UE0URkkU*?T*?T2pT3@TYSS`SUsPSO- S P-R'R7R7`RF70Rh7R7Q8Q pQ^'@Q8tQ3P3P P|H+PPl P?O?O 2O3`O"[0OONw#N.#pNĆ&@N&NpFlM,b6MDOzMnPMj| MkL2Lz3L`LaE0LRNL6EKEK>NpKvN@K_KJ\JvJ JQPJQ JIQIr I8Q`IV|50I4|5I|5HlQH8V)pHV)@HU)HGRG$GQPGQ GQFQFQF`FQ0FTFQEQEpEQ@E12E@ !D 0cDODOPDOR D$RRCx|5C<0cCj`CJ0C/cCQB BaEpBQa@B.BNA5AL5AO5At.PAf1 A??>z?`>0> &> &=|/?=~&p=x@=&)y=;;:P9 9776P6 5433P2 2100 0 `0 /k5p/z-@/ .Rap.a@.'.OS-D2-3-'P-2 -nn3,c,c,I`,<'0,',g+@+i4p+i4@+{4+H#*#*#*xP*y *R)O")4")$`)4(0)bC()w((n((8Cp(C@(Zz(g'x'Zc'x"P':" 'J;c&(?&,&,?`&,?0&2>H&2%¦3%QD.?.?`:033§6<`Sp>U7@[7&l78m,f-PB- ~6l6\N.N`b/c0tNuNpĐ(@i-zi-7]r-0-P-  -LG7tk7#.`|H0|H -ZZp(%,@~>M,'++P|x> *+Zj>@'`70j7xyp@Dp---P- o8k"$d$`#%0SN[p֘R@3c4v`HV`H\ P9 < 6]"P$.$`"0b"B" &?* G*p o*@ ., f" 6#. {H {HP <%> \ $ ;/ *>/`  40 H | `5 Lyp dz@ H /c `2' 4, XP 8  49ڔ `Be"0n"$"L"p,"@:*9*Po*,"P". {HzH %>)` *0~*`11_5py@}&}&hV66Pv6 V6y< 7`^q!0&+.7  p @4  z@ GP( ,+l++`70h)   p4@  b GH2cP- 7*΍*<?`?022ԏ32c<|p`S@cScSD)n.L.P1 Ʒ1|1r.`D0JH`]-p6~*@2cH Q2cP8 D-O &`1011.(1pʼ1@1X  s"$P$ ""9*`~9*0|o*,:"#.pz{H@Z{H77Pfp. X &6 & & &` &08E/87pT8@Er#`##jr0ʂ&PHp, (p,p,co,`n003c[3cn-p<3c@`3c~ B *HP~* XBD^K`B[0xIy?,z?p@|?`?P@? :Z:6(8 `x0>PaR''pL3@37-O.j6PP .1Ph `H 0N.>,8fpf@8PT>x>P2 l3c'C[`'05A6VO pB[1@_h_TIP.'P* WI`'x E`E0@EtE ep0k'@fi'{?x{?55Px5 ?c ('`h023.P2pX3@6*2"3P8O J?O O *5`@0 p@`h: 8YPl_ HEjE8E`(E09 9 9 9 pl9 @H@en@eAe@P0 hC\C`z0ؕ887p@rE6EEڷP:% 0R 2 E`E0.FCahFCpv<@0*Px:44P8 8jEE4`40r4pF8PF80F8p F8@(EJEhdhPDh $h8,&,`XI0bXIRW8P8japz8c@a5$5 ,ȩHPH N8Q""$`x0y4`H`Hp, @9 (f""4"P" :O*P*6k*v,`k*0"#.:}H}HpH,@&>Ȭ7HE8~Q56EPZE @98t3`T30&33п7,p΄,@WAKS8S8bP8PBP8 `aP[_`0^>gRм&\Y8p&@#!))_(Pt( +'b&E`܃E0^*B*йEEp*@޹11ܔHT+2+PH> +z>+hi>`40&жNp.@.D< M-T-P &oML'`ai0Ti5г.w#pʅ#@xyt&&Q6Pw# `#rx.y*5`H.0PQ5c6аOz"p$@"$0H`Pĸ'P T ) yPL&`dF|0ZhR9Э hgp?@X",''F,PK5 ?~K6bCD`<0rjRjЪ2jjp$8@8EدEiiPi iritEE`,0,AЧXAKpFR8@&R8T8(aa,,PҟE E~S C?`?02 3Ф 0@P 8hFF[`,[02?z%,П>\&,p\8@ 9x)T%p@_r_`0Nj#Сh#xp@Oz4t'"8(PP e<<ҙ<`Z0<<Оf<\`p?@h ,| ,u>6PƲ- 4-f'e',b'` b'0 G/"8Л"8Zp(8@N]`(|(\(RP, @,>##`#0DxyИCȫ!p`0@P5Q5"P4" n"X"Z$,%`40i'0'Е/'1p1@18nixPJ '89h<`TC0z<(Вl-{t5prz@t5"$> @ B D F  L N P R T V X Z ^ ` b !!!t x z |             ...                                $  * . 0  6 8 : < > B D F H J N P R V X \ j l p t  z | ~      vxТ0. ,Zrg` ТNv}rP75.@`Т```G y x Xlm<ˀET59P5>UbBE`G @  إlm<ˀ }-8P5>UMKQx3`G ШXlm<ˀ 98P5>Ud;":+  Z p   0 @ P P `  p  ` P 0 @ @ P `  p 0@P`0@P@@@@@@@@@@@@@@@@@@@@@@@@ `0n< `Z< `PЬ ` `p `@ `F ``0. `0Ю Fj` @F )Y~`@ @@N` `m@  @  ``f.3ު`.@@N`P`=,F E @  @  `` ``````G \`\ ȳlm<ˀ*nC+t03 >9P5>U$KQ`G Hlm<ˀ*Z2ͷ8P5>Us 3j~  @@@<@0`pp`p @P`p о@P@@@@@@@@@@@@@@`0``Pй` `p`@`0.`p j0`0j~ `P@@@N `!`c  p@  н` "`#`` `!`f.``P  !bn0B$`2=%`оP&` '`p(`@)`0*``+`0 ,`-`P2.` f/`p0`@.1`. 0  `@ `@7 `.  Z! J7@30 `Z! >@ 3@ p,0  22`,@3`4`5`6`7`8`   7PZ! 22`7`.  Z! J7@@ 3Pp Z! P@0F 03@ ,p B 29`,3`4`5`6`7`8` N R 7Z! 29`7. 0  T@J7@`3P T @pl 2:`,3`4`5`6`7` t x 7T2:`7 .@ p  Z! J7@3 Z! 2@ 3 0,  2;`,3`4`5`6`7`8`   7Z! 2;`7 `.  Z! J7@30 `Z!  @ 3@ p,0  2<`,@3`4`5`6`7`8`   7PZ! 2<`=`jc>`P}N?` Z@`p2UA`@dB`F  ``C`P0.D` $ jPD`P85-g=yE`p@  `@@pvf.@@ N~ؾvP&@@ Wf. 8L%vP@0@`NE`F`0  `0@  G`E`H`    Wpv@@@@f.pp3Rt`P..%`P@ .I` Qj@I`@)f:`0`@vN:`!`p@T  @  0  A` J`!`0D`K`L`G`:`M` `G`XM``N`P M` `G`M`0 ``G``v4.@ \  @@@@vf.PP# `@(.vf.@@`@(f.5W`@(f.PP~͡`@(&@@@@@b O`PG 0.G P`P`pp. `p.9` pPa ^vr..*TE`Q`pNvw*ULd9`Nv%̓-.?`R`?``@.2`pe Br.2``@Nv_,BČ.L``S`T`U`V` .;`p`i ~j;`P Nvmo?2 .0֖w` W`p.<`p pl #]r.<`Nv oy>.0`X`?`p@.Q``.:``.Y`P@p jY`K})AZ` @ @pNZ`!` x p@@t  `!`f.Oz2`.@@pNZ`!`  p@@  `!`f.5`.@`0.Z`0.[`  p/4j[`C>a\`@@@@N\`!`  @@  p\``!`f.<`. .\`p@.`@]`G @  lm<ˀmƌ8P5>Uqې  @@@<\[PXXR0RQQ@QP@PKJpJ JI@FEEPE::P::.!!P!! `  0@Pp    0 @@@@@@@@@@@@@@@@` `0  ^`  _` P _<``   p .a`p  Cj a` '8 Rb`00v0Nb`c`700<  pP@    d`e`f`g`h`J`c`i`b`j`0 `v04p.@f.pptF7` (..f."` (.f.pp"` (.@@vP@Nb`c`7`^ L P @D  H b`c`vP`4.@f.8` (.f.8` (.f.8` (.0@@`@P-`P)k` t7l`pB$m`@  `L ``0.n`0d yjn`@ރe`@   0@0@Nf.ppg \v@@Ne`c`(N p @l  o`f`p`q`e`c`Vhgg,3nr`s`t`ts^gf.#`.@  .e`  u``  $&v` 0!w`!!x`P!!^<y`!@" "!.z`!"" ׿j@"z`@"#%g0h``#@% %@#Nh`c` %   $$@  $  x`  h`c`f.`%`%'A?`@"......'P'@&Nh`c`P'< . '&@*  0'h`c`f.''|~g`@".....)p)@ (Nh`c`p)T F )(@B  P)h`c`f.))&n`@"....,+@@*Nh`c`+l ^ @++@Z  p+h`c`f.++J`@"...@-@P,Nh`c`- v P- -@r  -h`c`f.--q0N`@"..`.@...1`... .  944/74/.0 00  3@1J73@`13P321 135@p2 2b`,23`4`5`6`7`   * 43f.44UYv`..f.`4`4]2`.7432b`795. 5 P5  8`6J78@63p876 78@7 2{`,73`4`5`6`7`   *@98f. 9 9UYv`..f.99]2`.7982{`0:dB`::=`P::jc>`:@; ;:.|`:;; /Y4pj@;|`@;<T{`D`<@0@?<v=0@N{`c`0?<  p>>=@  0>g`}`J`c`i`{`v=0?>4p>.@f.p?p?&`@;(..f.??'LS)`@;(.f.p@p@'LS)`@;(.@@DCAvPA@DN{`c``CA  BPB B@  B {`c`vPA`CB4B.@f.CCM`@;(.f.DDM`@;(.f.DDM`@;(.E0?@=@`C@PAE~`PEE`E F. `EFpF@F.`@FFF  #jF`FPGSi*}`G@@`I@HN}`c``I8  IH@  0I  }`c`f.IIq`F..J,/`IPJC` JJz2`pJJ2`J`K@KK.`KKK? N!j`K``K LMKկg`NL@ L  NM@N@pJf.`N`NPNB 24InN`K@N@NNg`c` NpJf N OO@F  PJ ^`i`g`c``H`KpP@P.g`@P QPQPP.G d`PRd`P"pQ@Q.h`@QFQQ.}`QRQ.b`Q;`R0R.{`0RRRR.Y`R SSh LjRY`RSs&R>Z`S@UU@@TNZ`c`U| p @UU@l  pU]`c`f.UUHJ`R.@W@@VNZ`c`W  @WW@  pW]`c`f.WW/d`R.S0XX.Z`XXXPX.[`PXXX EhjX[`X`YNJԖ\`Y@@`[@ZN\`c``[  [Z@  @[\`]`c`f.[[s;`X.X[[.\`[@\\.]`\  /@}|pw wvv0vuu0utt@tssPssr`rrqpqkpk kjj0jibpb baa a``@_^]p\X`XXWpW WVV0VU    `  0@P`jgf cbb0baa@a``P``_`__^p^ ^]]0]\\@\[[P[[Z`ZZYTS`SSRpR RQMM0M IHH0HGG@GPCCB`BBApA>`>>0,+&`&& p @P p  P@P`PP`@ 0@pp ppp аpPzso0onn@nmpf f@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@Pf` fffpf.`pfgg Yjf`fgfC `g@p@i@0hN``i ( 0ii@  `i```$            ``f.0j0jt`fPjmpjpl.@kj9!m...m @@@@@@@@@@@@@Ћ@@@Б@@@@@@@@@@@@@`@mPjl`kNv6~ . mB`Pj`````````````````Z! . n+`mpny`@nn`no`ng`o0o.`0oooo.`o`soppPp0p6/!`s`s`@sop%ZhZ:`@q@p@r@qN``r  r`r@  r```f. s srm$`o``Z! .sss.`szsztz0t`zPt@zpt ztPuutEv!zz`z@z zzzz`z@z z`ysuv!n` v@p@ x@pvN``v x  pw@w@  w  x`````````X``y@xf.xxw!x.zxzx`zy@z y z@yPuyEv!yzz`z@z z`Z! .``````Z! .`Z! .`Z! .`Z! .`Z! .`Z! .0{{z.`z{p{ Bj0{`0{{HV"`P|@ p@~@|N``j~T  }p}@   }````~``````P~```D`X``~~f.! 0{ `"pl.8Q)!.ap`b Jj ` q `@@p@@N``j n `@f  ``j ``` p@f.e/! "pl.8Q)!.Pap`Z! .`Z! .Є0plM!&ʇ.kl[!f.@@sa`&p.C!&`Z! f.@@:`p@+.0O+`p@pp.~34`pЋ3.0 erNp& ybБ@pl. zrI+...I+6 R1`Б@+.`U40`Б@V4P0 I%r &pP bZbp@6ДU`p@+.D-.`p@pp.NN`pБ3. wzrN`P& 儼b@pl. xr&...&6 :`@+.@x `@V40 mr &P0 0ybP@6G`P@+.\ͥ`P@Pp.p`P` Nv&.`9V{f````````Z! .`Z! .p{0.` P.`P`М.`@ .` r j@`@<2W``@p@0@N``[0.  @    `````````f.ppo? `@I+@>J+&": Gj`"cO3`@p@0N``[^ F 0@>  ```B ````f.r]`>J+&"@Х@`N``MХ j `0@b  ``f ````f. Z`0&"P`0plM!&P0ʇ.pkl[!pf.ЧЧsa&0p.PC!&P`Z! f.ШШ:J+""@м@N``м> . P@*  ```f.]`J""P`0plM!&P0ʇ.pkl[!pf.ооsa&0p.PC!&P`Z! f.пп:J+""P`0plM!&P0ʇ.pkl[!pf.sa&0p.PC!&P`Z! f.:J+ 87@`6N``7  `707@  7```f.77!Fd0J@;0:@p8N``0:  p9@9@   9&```C+``t0``$``(`"```#` ;P:f.::G5Fa0:.;a ;`Z! .@=@;N``=  <`<@  <!`)`(`"```#`= =f.`=`=4a0=.=a=`Z! .1@>>.`>>B3-``>?>>.!`>@? ??@p?`?@?Vj@@? ?  ";3.PA0A 'lr??A.`pAA /`A@B 0`BB1``BBJD32`B0C3`CCCPC.4`PCCC uZAwjC4`C`Dk)+5`D@@F@EN5``WFt  FE@  @F``^`}` 6`3``7`8`h`   5``c`f. G GJ`CPjpGQb`@GCGG.5`GH9`G`H:`0HH;`HI<`HpIPI I.=` IMIJIIer!MM=`LpIJʖc)>`J@p@L@0KN>``8L | 0LL@x  `L`?`>``f.LLJ&`pI``Z! .`MU@`0MMA`M NNM.B`MpN`N j NB` NN ?)?`@O@@pQ@ON?``"pQ  P`P@  P`6`o`hg*gC``g ` `.g`D`?``!`f.QQ< ` NPj`NRQ.?`QPR`:` RRE`pRR`R@S2*F`SS@``SS `SPT0TT.G`TTT ɎjPTG`PTUqejEH`pU@WPW@UNH``PW   VV@  V  `8`7``6``I`J`K`H``f.WW3`PTPj.@`Y@XNH```Y"  YX@  @YH``f.YY `PTPjY`Y@Z_`ZZ``ZZ`Z0[L`[T[P[.H`P[[ `[ \4M`[p\K`@\\N`\]O`\`]P`0]] `]^6`]P^8` ^^0R{`p^^Q`^@_B$`__2=%``__&`_0` '````P``R`` a< S``paDT`@aa0U`ab-`a`bV`0bbk`bc`bpcPc c.W` ccc% fAjpcW`pc0ds,g1kX`d@@@f@dNX``@f> , ee@(  f``X``f.ffg`pcPj.f `fPg0gg.Y`gggB jPgY`Pgh;٨`ph@@ j@hN`` jb J ii@F  i````f.`j`jX`PgPjjjj.Z`j kke (DjjZ`jk[&d[`k@pm@@lN[`P`,m| l @mm@h  pm`[``f.mml`jm pnp0nn.npn\ ! pp pp\`PomPoNvkRy|W.o^`m]``^`_````a`b`Z! .c`Z! @pp.!(N`d`p@pNv4޽(e`G  (qlm<ˀ)7 prՍ`39P5>U Vf`G tsrlm<ˀW.9P5>U~+  P`p к0@P`p е0@P`p а0@P`p Ы0@P`p Ц0@P0P yxpx@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@xpr`pxx̩prg`x`y@yy.prD`yyy %Jj`yD`pr`y z*Z,NE`|z@pr z  |{@|@]f.`|`|P| O!n|`y@|@|NE`prh`|] T }}@  ~g`P L i`F j`B k`> l`: m`6 n`2 o`, p`( q`$ r`  s` t` u` v`  w` x` y` z` {` |` }` ~` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `| `x `r `l `f `` `Z `T `P `J `D `< `4 `. `$ ` ` ` ` `  ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `E`h``s`pP .pr1` .   pPЄ7. @  PJ7@p3` pr@ 2pr`,Ї3`4`5`6`7`   f.]2`.7@2pr`7P.   Z! J70@3@` Z! pr@  2G f`,p3`4`5`6`7`   7Z! 2G f`dprB`0pr=`jcpr>`PЎ.pr`Y@P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P L F B > P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P : 6 2 , ( $    P P P P P P P P P P P P P P P P P  P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P       P   P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P                    P P  | x r l f P ` Z P T P P P P P P P P P P P P J P P P P P P D P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P < 4 . P $             P P P P P P P P         P P  pr-``0.pr`0Р PBKj`pr@̥'A`@prp@P@N`prh`P  @  `  `h`f.V`." .pr`$ 0.pr`& P.pr`P( Ф.pr`* .pr`, p@.pr`@. .pr`0 .pr`2 `0.pr`0@.pr`@Ц.pr`Ц@P .pr` @p.pr`p@.pr`@@.pr`@`.pr``@.pr`@0.pr`@P.pr`P@Щ.pr`@ .pr`@p@.pr`@@.pr`@.pr`@`0.pr`0@.pr`@Ы.pr`Ы@P .pr` @p.pr`p@.pr`@@.pr`@`.pr``@.pr`@0.pr`@P.pr`P@Ю.pr`@ .pr`@p@.pr`@@.pr`@.pr`@`0.pr`0@.pr`@а.pr`а@P .pr` @p.pr`p@.pr`@@.pr`@`.pr``@.pr`@0.pr`@P.pr`P@г.pr`@ .pr`@p@.pr`@@.pr`@.pr`6@`0.pr~`05@.pr}`3@е.pr|`е2@P .pr{` 1@p.prz`p0@.pry`/@@.prx`.@`.prw``@.prv`@0.pru`@P.prt`P@и.prs`@ .prr`@p@.prq`@@.prp`@.pro`@`0.prn`0@.prm`i@к.prl`кh@P .prk` g@p.prj`pf@.pri`@.pr``.prY``3 cgjY`prpDKUZ`0н@prp   @@`v 4`.8 @NZ`pr`p`T H @D  Pf``f.]`.f.W J^vp@ @ @NZ`pr` n ` @\  f``f.``-`..prZ`0.pr[`pr  j0[`pr0=?\`P@pr@@N\`pr` z p@v  \`f``f.00%`0.pP.pr\`Ppr.prf``G 0gg(lm<ˀ p9P5>U& 6 `G lm<ˀ8P5>U-  f`fbb ]\\0\[[@[ZpZYY POO0ONN@NMMPM JIB <;;0;::@:99P9+p+ +*`    @   P @0`P@Pp``00@P`p 0@``p@@@@@@@@@@@@@@@@@@@@@@@@@p`ppN`@* p`p``p@`P0.p` HjP`pPM3V`p@pP@N`p`2D  @  ````````````````s```````````f.  9j`P...`@N`p`2b R p@N  ```f.00ѯM`P..@@N`p`2z j @f  ```f.@@c`P. p``0pU`0.p`@&P} vb@6EXU`p 0@p@.p`@u@.p`c@.p`h@`0.p`0g@.p`t@.p`v@P .p` n@p.p`pw@.p`p@@.p`;@`.p``2@.p`/@0.p`<@P.p`P.@.p`_@ .p`]@p@.p`@@.p`}@.p``pC`0.p`  ˧j`pM%9`p@ @v N`p`@@  `@   `K`J````0 `pj`  `N` 06`P`p j`  ``@ pM` ````j`0 `6```v@4.@f.i"`(.f.i"`(.f.``i"`(.@@@.p`^@`0.p`0$@.p` .p`p` Gj `p /kZZ`@@p@@N`p`  `@  `````f.00` ...``.p``p%`P0.p` `٩jP`pP>E㩠`p@p@@N`p`D  @  ``f.PPHr`P....p` .p`p`I j `p ێ9\`@@p@@N`p` P `@L  ````f.005g` ...``.p``.p`Y0 p.p`p. zTj`pNvN_p$Π.8S`0.p`.p ޼3j0`p0Nv@C0.0t4 L`0p`Pp*` p`pp`@p`0.p`p ZujNj0`p0v&y`P@p@@N`p` p@  ``f.00K``0.pP.p`P.p`Q P0.p`Q `.p`` }j`pps'=V!`@p@p@ N`p`p! @  P``f.U`....p``!p`04pM` .p`p.`#! !}j `p Nvʟ"r. o` pp`@.p`` . &! S=r@ * I `p0  Nv;:\/. m`` p`P  p`  py` p p `@  p` 0   .p`  .p )! 74+r@ @ `pp 0  NvзyZW!.P uya`0 ```` p` @  .p` -! C`@p p @ N`p`pp N# B# @8#  P <# ``f.  Q# լv"p"@ !N`p`]p"h# Z# "!@V#  P"``f.""k# xv0 $p$@ #N`p`Kp$# t# $#@p#  P$``f.$$# sv&p&@ %N`p`p&# # &%@#  P&# ``f.&&d(p(@ 'N`p`p(# # ('@#  P(# ``f.((JwZd@p*@ )N`p`~p*# # *)@#  P*# ``f.**OHod+*.p`*P+ +.p` ++p+.p`p+,++.p `+ @,,,,0998888p8P80887777p7P70766`65@544P4433222110//..P..- 0-# #  .# # p.# # .# # 0 P/ /# #  #  0 //# Q$ $ 0 P0 0$ $  $ 0 00$ $  $ 0 P1@1$ Q$ $ 0 11$ "$  $$  0 p2@2($ ,$  .$  22$ 8$ 0 P3 3:$ >$  @$ 3D$ QH$ 3L$ P$  4R$ V$ p4Z$ Q^$ 4b$ Qf$ 0 54j$ p$  r$ 0 5p5t$ z$  |$ 0 066~$ $  $ 6$ Q$ 6$ Q$ 0 76$ Q$ $ @7Q$ `7Q$ 7Q$ 7Q$ 7Q$ 7Q$ 8Q$  8Q$ @8Q$ `8Q$ 8Q$ 8Q$ 8Q$ 8Q$ 9Q$  9Q$ @9Q$ 9p `P99p `9 :p``9p:pO`@::p `:;pL`:`;p `0;;p `;< p,`;p<P< <.p1` <.< <  A=7A=.> @>  Z! P?J7A@p?3`A@? ?Z! p@@$ 2p`,@3`4`5`6`7` $ $ 7AZ! 2p``B@BB.p`BBB?% a"j`B`p`B C%< `[@ `\0\.p`0\\\.p`\B]\.p`\p]P] ].pY` ]]]o& D2-jp]Y`pp]0^dB@Z`^@p`0`@^NZ`p`0`& v& __@r&  ```f.p`p`p<`p].@0b@`NZ`p`0b& & aa@&  b``f.pbpb*`p].]bb.pZ`b@c cb.p[`bcc& JFj@c[`p@cdwQ\``d@p@f@dN\`p`f& & ee@&  e\```f.@f@f ~`@c.cf`f.p\``fpff.p`f & Z@Ш`p Р0@`p Й0@P`p Д@P`p Ќ0@P}s@srrPrrq`qqpj`jj@@@@@@@@@@@@@@@@j`jj``jkjj.`jPk@k& Ǔ jk`kki` l@@m@plN``m& & pm@m@&  m`& & ``f.nn& CS,vk0no.o& VMr.@&npn& b.@6Ponl:y`.@+.0o)`n `p0n0pNvJ{G.ppa@`0nJ`!` ``p+`p@q"`qq#``qq`q0r$`rr /`Prr`r s%`rps`@ssss.&`s0t t& (EAjs&`stTcQCw'`u@@wv@PuN'``v8' ' Pv v@&  v  (`%` ' ' `' ' '``f.ww;' Eq5vs.?{0y@wN'``0y' ^' x`x@@'  x  )`Z' V' R' `J``N' *`H' D' '``f.pypyw}z`s.y{yz.`zz !@z{*{+`P{yzNv#6[.0{_{`y)`J``*`(``Z! .@P}@|N'``P}' ' }|@'  0}' '``f.}}d`s..~}}.1`}.0~ `~  0p7P.   Z! J70@3@` Z! @ ' 30p ,` ' 2+`,p3`4`5`6`7`8` ' ' 7Z! 2+`7Ѕ.   0J7p@P3@ ЇN@`( 2 `,3`4`5`6`7` ( ( f.ЉЉ]2`.7 2 `dB`PЊ=` jc>`pv`@,`-``.`0/` tЌ.'`ЌP0` 1`p `@`"``2`03`4`PЏ5` 6`p7`@.8`0 S) ѻj8`9`@@`@PN9``h`* ) P @V)  ) ) ) ) 7`6`^`}`|) v) ,```r) n) f) b) '`/`^) Z) `9``c`f.`.0p. Д.9`ДP0R{` j:`p6`@``B ;`` `0<`T`PЗL` =`p `@` `` `0>`8`ЙP ` ?`p@`@)A```.D`P@* jD`Ě'R.E` @@@pNE``* * p@@*  A`@`?`8`E``f.  QQ`.p`@V`m``-`0f/`0*`РP\ `  ,`pP`@k@.`y`.+``0n. `P0.Y`* ZejPY`PmG_|Z`p@p@NZ``* * @*  ``f.PPe`P.@@NZ``* * @*  ``f.PPl`P..Z` Ш.[`Шp`* ix^j [` 9UP\`@@@@N\``+ * `@*  \```f.  4` .`p@.\`@.`B`G `lm<ˀW8P5>U 1P }4 + @@@(@0 `   p   0@P`0p 0` а0@@@@``C`0k` а.D`а@` kDc!D` P,/y`@@`@N`E`G`&+ + г@+  0F`G``E`f.rc` .G`F`F`Z! .G`Z! .pP .H` )+ L=jpH`p0YI`@@@NI`E`F@V+ 0+ @,+  D`J`C`I`E`f.G(<`p...@P@NI`E`FPj+ ^+ й@Z+  0I`E`f.ɰ`p...K`0pgG!K` gL`@@ @мNL`E`= + r+ н@n+  G`L`E`f.`` _`.G`G`Z! ..M``P+ + jM`пcN`0@P@NN`E`<+ + P@+  K`J`N`E`f.  H`...@@NN`E`<+ + p@+  N`E`f.00?`..``.O`P@+ WjO`BL(LgP` @@@pNP`E`4+ + p@@+  Q`P`E`f.#`...`0.R`0`@@ 9!`@`@R` XAfgFL=S`@@@`NS`E`)+ + `0@+  F`G`S`E`f.;Wv`.F`G`G`Z! .F`Z! ..T` + a}jT`詆U`@@@NU`E`'", + @@+  pR`J`U`E`f.ƻ`...@@`NU`E`'6, *, `0@&,  U`E`f.D`..pP .V` P00z:!P0P0V`ppB[wW`@@@PNW`E`P, >, P @:,  F`G`W`E`f./I`p.G`F`F`Z! .G`Z! .p.X`pS, ꋳjX`XHRY`@@0NY`E`x, Z, 0@V,  `V`J`Y`E`f.8`.... @`NY`E`, , `0@~,  Y`E`f.\>0q`...@@pNY`E`, , p@@,  Y`E`f.:`..`0.1`0.    pP@ 7.  P  `J7@3p @, 2Q`,3`4`5`6`7` , , *Pf.  f`...f.UYv`..72Q`70.P   J7@3 0#@, 2U`,3`4`5`6`7` , , *f.PPf`...f.UYv`..72U`7`.   J7@30 ` 8@, 2N`,@3`4`5`6`7` , - *@f.f`...f.UYv`..7@ 2N`7.   PJ70@3@` P1@ - 2P`,p3`4`5`6`7` - $- f.f`...7P2P`7@.`   J7@3 @@2- 2Y`, 3`4`5`6`7` :- >- *  *@f. !;`....f.f`...f.``UYv`..72Y`7.  P  `J7@3p C@P- 2I`,3`4`5`6`7` X- \- *Pf.  f`...f.UYv`..72I`@dB`=``jc>`0.``P` J`pl`@.D` `2!D`>Zm7 E`p@@ @NE`E` ~- l- @h-  F`G`E`E`f.``f`.F`G`G`Z! .F`Z! . ``0.Z`0- FjZ`@[1i#3Q`@ P @NQ`E` P - - @-  D`J`Q`E`f.   `...@` @ NQ`E` ` - -   @-  @ Q`E`f.  ŏ `..  .I` PP  .N` @ p .P`p   .Y` @  .Q`  ` .U``   .Y` P@- TjY`~4LZ` @ @pNZ`E`- - p@@-  B`E`f.y`.@@pNZ`E`- - p@@-  B`E`f./e`.@`0.Z`0.[` - !Mj[`63 )NS\`@@@@N\`E`. . @@.  p\`B`E`f.8``. .\`p@.B`@ . /0pP`p 0@P`p 0@P0@` 0@`OONJJ@JIIPIIH`HD`DDCpC?p? ?>>;: 1+`++*p* *)%p%!!0!0@P`0p  0 ` ` `@Pp 0 к0pPЪ@Кp Ќ0 Ё}}zy0vupojipi i@cb0[ZZ@ZYPVVU`UUHHPHD`DDP@@?`??;@;::2p2 2110100@0,`,((@(''P''&`&&%p%!!P!@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@!p`P!!p[`!@" "!.p`!""Y. O|j@"`p@"#zfz ``#@p@%@#N`p\`x%. l. $$@\.  $]``. `f`\`f.P%P%hz`@"."%p%.p`p%%p^`%@&p(`&&p_``&&p+`&0'ip``''jpa`P''pb`' (pc`'p(pd`@((0pU`(0))(.pe`()p). rj0)e`p0))[#f`P*@pp@,@*Nf`p\`X,. . +p+@.  +g`s`b`f`\`f.@,@,?`0).p),`,.pf``,-,,.ph`,P-@-. j-h`p--+i` .@p@/@p.Ni`p\`P/. . p/@/@.  /`j``k`i`\`f. 0 0~`-@p@-p0@0.pi`@00p `01p `0`1@F)pl`011pm`12p`1P2pO` 22pn`p2322.po`2`3P3. nj3o`p334_dLp`04@pP65@4Np`p\`I5/ . 5P5@.  5J``7`. p`\`f.0606/ {ߦv30np88@6Np`p\`G8@`=Nv`p\`?>l/ ^/ `>0>@Z/  >r`v`\`f.>> d*n`;.0<@??.pv`??pw``??px`?0@py`@@@P@.pz`P@@@o/ j`QPPQNv:`K.Q3`P```pRpL@RNvW2:'U.R2 `pL T`U````V`X```@T@PSN`p\`TN0 @0 PT T@<0  T``\`f.TT`@I.N@E@UU.p}`UIU`U.p``UUp`U0Vp`VVVPV.p`PVVVQ0 QGjV`pV`WA}mj`W@pp@Y@XN`p\`Yz0 X0 YX@T0  @Y````}``\`f.YY `V.@p Zp `YpZp`@ZZ wp`Z["p`Z[`[0[.p`0[[[0 "+j[`p[@\fK`\@pp^`^@\N`p\``^0 0 ]]@0  ^j``0 0 ``\`f.^^`[.@p.`p`@ _N`p\`p`0 0 `_@0  P```\`f.```[Pj@p@b@0aN`p\`b1 0 0bb@0  `b``\`f.bbc`[.@p cpf`bcpc@c.p`@ccc1 xNjc`pcPdO.rIj`d@pff@eNj`p\`f>1 1 fe@1  0f`S`f``1 1 j`\`f.ff?q`c.N@h@@gNj`p\`hf1 N1 @hh@B1  phT`U``J1 F1 j`\`f.hh L`c.pLPip0` iip`piip`i`j@jj.p`jjji1 X0j`j`p`j k~4`k@pm@m@kN`p\`@m1 t1 ll@l1  mp1 ````\`f.mmL``j@p@Po@nN`p\`Po1 1 on@1  0o1 `\`f.oo#``j@pop`oPp0pp.p`ppp1 K2jPp`pPpqZ|˓`pq@pps0s@qN`p\`0s1 1 rr@1  r`1 1 ``\`f.psps!;`Pp@p }@u@sN`p\`u82 2 tt@1  u  `1 `1 `1 1 ```\`f.uu!gS`Pp@pvpI`uv`v0v.p`0vvv;2 ^$Zjv`pv@wݱN`w@pp@Py@wN`p\`PyT2 B2 xx@>2  y`I```\`f.yy`v@pyp.`y`z@zz.p`zzzX2 Nj`z`p`z {QZn,`{@p@0}@{N`p\`0}2 h2 ||@\2  }`d2 `2 `\`f.p}p}S``z@pL}pl`}@~ ~}.p`}~~2 Dj@~`p@~&``@p@@N`p\`2 2 @2  ```\`f.PPk`@~.t,hp2`pQ`ЁpP .p` 2 YS#Hjp`pp0ƻ06`@p@@N`p\`@2 2 @2  Q```\`f.2 DTvp0ML`@N`P`+`3 2 І@2  0`]`V``f.~Z`pmЇ. @@N`p\`43 3 @@3  p|```Q```\`f.MX`p0Mt@@pN`p\`L3 <3 p@@83  ``\`f.gŧ`p@p.`p`0pk` Ќ.p`Ќp`O3 qj `p `@@pp@@N`p\`t3 Z3 `@R3  `k```V3 ``\`f.PP'h` .""А.p` w3 mD3jА`pАbGyQ>`@pp@@N`p\`~3 ~3 @@z3  p````\`f.9,`А.""@@`N`p\`w3 3 `0@3  ``\`f.!E`А."Pp` p`p.p`0pFd!`p OдL`@p@0@ИNL`p\`n03 3 Й@3  G``L`\`f.ppqi'G`.G`G`Z! . К.p`Кp`3 y{j `p C{#%`@@pp@@N%`p\`n3 3 `@3  %`\`f.  Q` .ppY`@.p`0 3 `4,j`p ݫN`@p0@PN`P`)3 3 P @3  `]``f.s`m.P@N`p\`e 4 3 P@3  Y```\`f.  Dzf`0M".`@N`p\`e4 4 p@4  Х`\`f.00y`0M"p@N`p\`d64 &4 @"4  ``\`f.@@mU`@p..@@N`p\`dJ4 >4 @:4  `\`f.PP#`@p.p` Ъ.p`Ъp`M4 aj `p n4P`@@p@@N`p\`]b4 T4 `@P4  ``\`f.  0}` ..p`PЮ.p`@0e4 h!j`pGU8z`@p0б@`N`p\`Pб4 t4 `0@h4  ```p4 l4 `\`f.4 :vpL@@N`p\`B5 4 P@4    R`T`4 ``S``4 `\`f.PP5  vNp.p`p 5 T j`pl/i9`@pp@0N`p\`5 5 5 0@5  `T``\`f.#5 "zvpL@@0N`p\`4@5 ,5 0@(5  `S``\`f.C5 hs;vNp``p`0p``к.p`кpP .p)` G5 jjp)`pp0s}RL*`@p@P@N*`p\`+Pp5 X5 @J5  `R5 ``N5 *`\`f.+tZ`p..p`P@s5 P,wCj`pX>x:` @pp@@pN`p\`+5 z5 p@@v5  )````\`f.zL`.`p `0p`:p`P_Op` p.p`p5 ْj`pWLJ~ƥ`@p@@0N`p\`5 5 0@5  ``q``` ``\`f.5 Kd\vpL0p`pV`Pp` p `p p,`@.p`0 5 Yj`p}aUo`@pp@PN`p\`5 5 P @5  `\`f.Gֵ`.@@PN`p\`6 5 P @5  ` ````\`@f.  kaa@`Z! . `.p``.p`P@ 6 " j`p LG` @p @pN`p\`# 6 6 p@@ 6  S``\`f.#6 jvNP@pN`p\` L6 ,6 p@@(6  ```````\`f.00O6 vpLP@N`p\`$h6 X6 p@T6  `\`f.00ڻ`.@@N`P`c6 p6 p@l6  ]``R``f.@@mW``pn._J!p`Z! NpP .p` 6 jp`pp0iK$`@p@0@N`p\` 06 6 @6  ``\`f.pp6 {4vppL.p`0 6 ]j`p=ƂwA3`@p@@PN`p\`6 6 P @6  ```\`f.6 ~!QvpL @.p``.p``6 Ӫj`pph`@p@p@ N`p\`p6 6 @6  P``\`f.6 4vpL.p`pP .p` 6 󃑉jp`pp0Q'܇`@p@0@N`p\`06 6 @6  ``\`f.pp6 wvppL.p`0.p`p7 @V)j0`p0.!d`P@pP@N`p\`7 7 p@7  T``\`f.007 MAv0pL@@N`p\`B7 .7 p@"7  `*7 &7 `\`f.@@X`0.`.p``E7 L~`Aj`pp,;! ,`@pp@p@ N`p\`p\7 L7 @H7  P``\`f._7 8#vpLp`pP .p` c7 ek!jp`pp0yM԰`@pp@0@N`p\`0z7 j7 @f7  ``\`f.pp}7 R}vppL.p`.p``0.p`07 Cj`p@?`@pP@N`p\`P7 7 @7  ```\`f.7 DvpLP@N`p\`P7 7 @7  0S``\`f.7 <:PvN`@N`P`b`7 7 @7  0]``R``f.yA``pn.@_J!`p`Z! N@ @N`p\` 7 7 @7  `\`f.``Z `p%`p``pP .p` 7 jp`pp0NdY (`@p0@N`p\`0 8 7 @7  S``\`f.pp 8 v,pL@0@p/N`p\`0F: :: p0@0@6:  0`\`f.11I: ]av,Np1P1 1.p` 111M: ߢ@jp1`pp102\hD`2@pp404@2N`p\`04`: T: 33@P:  4`\`f.p4p4c: Kvp1pL606@4N`p\`06x: l: 55@h:  6`\`f.p6p6{: vp1N808@6N`p\`o08: : 77@:  8`\`f.p8p8Yd`p1@p"@P:@8N`p\`mP:: : 99@:  :````\`f.::m`p10M":p`:`;@;;.p`;;;: 8Zj`;`p`; <z.|S`<@pp@ >@<NS`p\` >: : ==@:  >S`\`f.`>`>: )jv`;N>p`>?p`>P?pk` ??p@`p?@??.p`?`@P@: #iaj@`p@@vzG``0A@pp@C@AN`p\`zC; : BPB@:  B  ``S```R`````\`f.PCPC; uv@NC4pM`pCCp-`C@Dp$`DD*Pp``DEDD.p`DPE@E; CjE`pEE"rz` F@pp@G@pFN`p\`pG2; ; pG@G@;  GG``\`DR`f. H H&`E..O.@EH`H.p``HHp`H0Ip`IIp`PIIp.`I Jp`IpJpq`@JJB p;`J0KKJ.p`JKpK9; j0K`p0KKP$M`PL@pp@0N@LN`p\`i0Nx; H; MpM@<;  M  q``.```@; ```\`f.pNpNm`0K..O..pKNN.p`N@Op`OOO`O.p1``O.O P@@@  `@ pP0pP0`@ `@~ ~zyuu qqlk`g@gbb ^^VVR7PV0R.PR R  USJ7U@S3UTT 0TUp@T; 2p`,U3`4`5`6`7` ; ; f.0V0VB7D`@pL7VU2p`7]V.V W  P]ZZ0XJ7pZ@PX3@ZYX XZp9@`Y; 2p`,Y3`4`5`6`7` ; ; f.ZZ< *vNJ70]@[3]@\`[ [P]pK@ \$< 2p`,p\3`4`5`6`7` ,< 0< f.]]W< 7)vpL7]ZP]2p`7`b@^.`^ ^  b_J7a@_3a`` @`bp@`\< 2p`, a3`4`5`6`7` d< h< f.@b@be`@p.7bb2p`7gb.c 0c  f@dJ7f@`d3Pfed dfp~< pev< 2p`,e3`4`5`6`7` < < f.ffA`.@p70gf2p`7kg.g g  @khJ7 k@i3j0jPi i@kp@j< 2p`,`j3`4`5`6`7` < < f.kkA`.@p7k@k2p`7p l.@l pl  omJ7o@m3onm nop@n< 2p`,o3`4`5`6`7` < < *`ppf.@p@p-`@pf.pp`@p7po2p`7`u@q.`q q  urJ7t@r3tss @sup@s< 2p`, t3`4`5`6`7` < < f.@u@u-`@p7uu2p`7yu.v 0v  Z@wJ7y@`w3Pyxw wZp1@px< 2p`,x3`4`5`6`7` < = 7yZ2p`7} z.@z pz  Z! {J7}@{3}|{ |Z! p@|= 2p`,}3`4`5`6`7` = = 7~Z! 2p`7 `~.~ ~  Z! J7@3Ё0 `Z! p@(= 2G e`,@3`4`5`6`7` 0= 4= 7PZ! 2G e`7.   `J7@@ 3Pp `p,> 0$> 2pv`,3`4`5`6`7` .> 2> f.]2`.7`2pv`7`@.`   J7@3 @pY@ЉB> 2p`, 3`4`5`6`7` J> N> f.@@UYv`..72p`7. 0  @J7@`3P p@pd> 2<ˀ0`,3`4`5`6`7` l> p> f.A`.@p702<ˀ0`7. А  @J7 @30P @p@~> 2pj`,`3`4`5`6`7` > > f._ˡk`.pL7Д@2pj`7P .@ p  J7@3З p@> 2p`,3`4`5`6`7` > > f.  k3`.""72p`7Й.   0J7p@P3@ Лp(@`> 2p`,3`4`5`6`7` > > f.НН]2`.7 2p`70p.   Z! ПJ7@3 @ pZ! pL@> 3ТP ,@ > 2p`,P3`4`5`6`7`8` > > 7`Z! 2p`7Ш.Ф   pJ7P@03 ` pp@@B? 2p`,3`4`5`6`7` J? N? f.0v`.t7p2p`7P.p   Z! J7@Ъ3  PZ! p@b? 30 `,  ^? 2p`,03`4`5`6`7`8` j? n? 7@Z! 2p`7@.   PJ70@3@` Ppa@ ? 2p`,p3`4`5`6`7` ? ? *pf.?`@p..f.  e`@p.7pP2p`7.   @ J7`@@30p pt@P @ 2p`,3`4`5`6`7` @ @ f.`."J7 @30P @p{@(@ 2p`,`3`4`5`6`7` 0@ 4@ f.k3`.""7@2p`7@.`   P]J7@3 @P]p@оF@ 2p`, 3`4`5`6`7` N@ R@ 70P]2p`7@.   P]J7 @30P P]p@^@ 2p`,`3`4`5`6`7` f@ j@ 7pP]2p`7.   3) J7`@@30p 3)p@Pv@ 2p`,3`4`5`6`7` ~@ @ 73)2p`7.  P  Z`J7@3p Zp@@ 2p`,3`4`5`6`7` @ @ 7Z2p`7`@.`   J7@3 @p@ @ 2p{`, 3`4`5`6`7` @ @ f.@@A`.@p72p{`7. 0  Z@J7@`3P Zp@p@ 2p`,3`4`5`6`7` @ @ 7Z2p`7@ .@ p  J7@3 p@ @ 2pp`,3`4`5`6`7` @ @ f.  ]2`.7p2pp`7.    J7`@@30p pj@P@ 2p`,3`4`5`6`7` A A f.H@`0M"72p`p p/`@jcp>`dpB``0M`. ``p`0p)`PPP.`Pp` pw`@px`p``.p`P@A Aj`pLn&(` @pp@@pN`p\`E0A A p@@A  `x``\`D`f.  圎`.p0p*`@_<p`DpT``0.p`0 4A @.p`j0.p`pP.p`PV:.p`0 .p`cp@.pj`@[.p`@.p{``0.p`0V.p`.p`vP .p` zp.p`p~.p`@.p```.p``.p` 0.p`pP.p`Pp.p`@ .p`p@.p`@@.p`.p``0.p`0.p``".p`@,P .p` p`p1.p`@.pT`;`.pS``P@.p`N0.p`pLP.p`P@p.pd`@ .pY`5A l_`j@Y`p@eZ``@pp`@NZ`p\`2HA C f. 6 6UrJ`Pj7p652 `7<6.6 7  Z!  8J7`<@@830<p;8 8Z! e@P;HC P93 ;`:9 9,: DC 2`,;3`4`5`6`7`8` PC TC 7<Z! 2`7`A=. = P=  @`>J7@@>3p@?> ?@@?C 2`,?3`4`5`6`7` C C *D@f. A A`@A*7A@2`7FA.B 0B  E@CJ7E@`C3PEDC CE@pDC 2?`,D3`4`5`6`7` C C f.EEUrJ`Pj70FE2?`7JF.F F  @JGJ7 J@H3I0IPH H@J@IC 2<ˀE`,`I3`4`5`6`7` C C f.JJUrJ`Pj7J@J2<ˀE`7@O K.@K pK  NLJ7N@L3NML MN0@MC 2 9`,N3`4`5`6`7` D D f. O OUrJ`Pj7pON2 9`7UO.O P  Z!  QJ7`U@@Q30UpTQ QZ! ;@PTD PR3 T`SR R,S D 2`,T3`4`5`6`7`8` D $D 7UZ! 2`Vjc>`U`VdB`0VV* `VW"`VPWh_<` WW<`pWW`W@Xf/`XX ,``XYXX.`XPY@YD NjY`YY9o` Z@@\@pZN``0\D D p[@[@D  [  +`&````````` ```f.P\P\#"`Y.\\p\. `p\\P]0]]D &]r.]i[`^]].`]^^p^P^E #4>r.^B` _(+`^_p_@_.`@__ ``_E `rЕЕ.``kM:`Е`T<``a`.&``paPa a.` aPax0`ab`aPb1` bb&O`pbcbb.`b`cPcE gqjc`ccҌLݚ7`0f0d@ `d  epe@e@If.fff E `$nec@e@fN``#eIhE E gPg@ E  gDDD``+`````&``````` ```j?````t0`s```` `!`0Vj"`4?1`NЕ3`#`7`>R)0P@??_^\$`%`&`'`(`63`)`*`+`,`#`-`Pcji.`i`jt`0jjv`jk`jPk.` kk/`pklkk.0`k`lPljE (jl0`ll*vY1`0m@p@on@mN1``nE rE nPn@nE  n/`1``f. o ooE jwnnl@q@oN1``qE E p`p@E  p.`p1``X2`3`f.PqPqƗ`l.Plqpq.1`pqq0*`q@r_<`rV:r`r.4``rrTJ+`r0sR+`ssJ+`Pssf\+`s tg+`spt+`@ttt.`t@Yut.`tu`u0u.+`0uR cuu.X`ugvu.`uk`v0v.[`0v`vv.`vwv.`vPjPw w.` wwwpw.Y`pwxxE 4jwY`wxMZ`x@pzz@0yNZ``zE E 0zz@E  `z``f.zzޙp}`w.@|@0{NZ``|E E 0||@E  `|``f.||E`w.x }|.Z`|}p}@}.[`@}}}E NX5j}[`}P~L)bU?\`~@p@P@N\``PE E @E  0\```f.k{`}.}.\`0.`5`G Ђ lm<ˀ* pBfG9P5>UpҒ4 0F 0pP`p 0`0@PP`p 0@P`pи0@P`@P`pP`p Р0P`p И0@P`pP@@@@@@@@@@@@@@@@@@@@P`PЇP9`@ .P6`QF wj@6`P@/bI7``@P@@N7`P`epF XF @TF  `_``7``f.PPPf`@mp.P7`pP`@P`Px``Pj`0P`P.P8`PsF R{j8`P`4IYn9`@P@ @N9`P`U G F @vF  @``]```F F o`hg*g:``gF `j`x`F ~F `.g;`zF 9``f.``G` pn._J! p`Z! NpP`@ P `P<``0.P=`0ГH j=`P@eeNa>`@PЖ`@N>`P`-`RH H @ H  ``6`<`>``f.ϱ-`m(/@p@ N>`P`-phH ZH @VH  P`>``f.HE`mP`ИPP` P`pP~`@P`PN``P?`0*PP`PP`PЛPK`@ .P@`kH Sj@@`P@[EukA``@P@ @NA`P` H rH @nH  ``_`K``A``f.``$3`@m.PA`P_``P`0P1`4PM`РPiP` P3`pB P;`@Pm`PL``P`0P `Py`PУ.PB`@0H `mĥ PD`PЬP6` P`p@.PE`@ЭuI $jE`PP<`F`@Pp @NF`P`VJ I Я@xI  0]``I I `` `o`hg*gG``gI `|I `.g``F``f.@@mq``pn.jJ!p`Z! pL@@@pNF`P`@&K tJ p@@bJ  ]`S`o`hg*gH``glJ ``fJ `.g`F``f.@`@pn. _J!@p`Z! NЭ`.PF``P`0P `PO`PжP8`@ .P`pP`@PA`P```2*PF`0P:` и.PI`иp`1K Kj I`P X02J`@@P@@NJ`P`lK `0dPB`0P*`PP`  P,`pPd`@PP``.P>``.PN`0.P9``P.PJ`Pm.P\`@ .PY`L vj@Y`P@Z``@P`@NZ`P`L L @L  5``f.@@X{`@.@@NZ`P`L L @L  5``f.@@C*q`@.p.PZ`p.P[``PL j[`P'gb \`0@P@@N\`P`M L P@L  \`5``f.NP`.P`0.P\`0P.P5`f.#I `m@N``FM M `@M  `8`H` `` f.``[aPj. `Z! P@N``P\M PM @LM  0``pf.}eaPj `Z! @@PN` `sM dM P @`M  J`7````@f.¨a.@ `Z! Z m`` `0 ` P`P. Q`@0M VxjQ` g3P`@ @@`N` ``M M `0@M  ```R`P````f.  `.p `@ k`Qc ``0. S`0M 8RjS` @q_>`@ @`@N` `Z`N M @M  ```T```f."*E`.< ``@. U`N j`U` ` sWS` @  @ @ N` V`-@ .N N  @N  ``V`W`G P= = X lm<ˀ2*v Pp q9P5>U+_ X`G P   lm<ˀT&*C+|n Pp _9P5>U:ե!L3 2N <<98@322P221`11 -p,`&&"P"P`p @Pp    0   p 0@P@0P0@P@PP ОPp P`p Ї0@~`~pw wjjPjji`iihph haa0aQJC;`;;:p: :990988 3p, ,++0+**@*))#p 0@P`P@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ `0 ` `P. Y`@0sN UVjY`  Z`@ @P@`NZ` [`PlO N `0@vN  `o`hg*g\``gN `N `.g~N zN ``]`-`^`Z`[`f.zOP`... x`@  ` :`` 9`0 ?` `P `  `p `@ 0` `` _`0  ` \`P `  t`p0. Z``@. ``###` 0  sG!######`` P#` W a`0!@ @"@!Na` [`"O O "P"@|O  "`W`b`Z`a`[`f.0#0#*}```W`b`b`Z! .W`Z! .`Z! .0$$#. c`#$p$O VC j0$c` 0$$8Zd`P%@ @ )@%Nd` [` )U O &p&@O  &FFF``e`f`<`g```h``\` `o`hg*gi``gO `O .gj`_`k`l``m` `O ``O O n`V``S`o`O `O p`O 9`q`O :`r`D`s`t`|u`O ) `v`w`x`x``y`O ]`d`[`!`DR`f.`)`)<`0$.Pj...)i z`) *2* {`)p*2* F`@** .`*+ `*`+ |`0++ %`+, `+p$P, ,. d` ,,,p,. }`p,3,2-2 -2@-2`-`2-@2- 2-.P..A'!32222`2@2 232222`2@2 2}` 1,/Jo~`p/@ @p1@/N~` [`p1V @V 00@==>˘! BBBB`B@B BBAA BBBB`B@B BBAA` `A<>,``?@ @A@`?N` [`WA[ Z `@0@@Z  @  `````W```````[`f.@A@Ah`< ``W`````````Z! .`Z! .`Z! .`Z! .`Z! .`Z! .`Z! .W`Z! .`Z! .`Z! .PC0CC. `CpJpCPJC0JCJCICIDI0DIPDpIpDPIDE0EDX! pJPJ0JJIIIIpIPI pJPJ0JJIIIIpIPI` HPCFKhI ``F@ @H@FN ` [`WH[ [ GG@[  G```W````````H``s`` `[`D`f.HHM`PC ``W`````````Z! .`Z! .`Z! .`Z! .`Z! .`Z! .`Z! .W`Z! .`Z! .`Z! .JJJ. `JQKQ KQ@K`Q`K@QK QKQKPKPLP L ML`LP! QQQ`Q@Q QQPPP QQQ`Q@Q QQPPP` @PJM|`M@ @O@@NN` [`kO[ [ @OO@[  pO  `````W```````[`f. P PO<`J ``W`````````Z! .`Z! .`Z! .`Z! .`Z! .`Z! .`Z! .W`Z! .`Z! .`Z! .0RRQ. `QRpR[ Zj0R` 0RRCo_`PS@ @pU@SN` [`_pU\ [ TpT@ [  T``1`j?``e````f`<`g`````[`&`f.UU` 0R..a.]pX. V0X@VX`VW.VV!0XX0XX` W VpWNvtKۭog.W[` V``````Z! rb`Z! PX*I+XX\ ܭjpX` pX0YoueS`Y@ [0[@YN` [`F0[\ \ ZZ@\  [``[`f.p[p[@u9`pX.[.@p]@\N` [`_p]\ \ ]\@\  @]```[`f.]]`pX. V`^` ^`@^``^_^lM!&`0_^ʇ._kl[!``f.p_p_sa_&`p._C!&``Z! 0`f.p`p`:c 2 `,3`4`5`6`7` Fc Jc f.u6`@ &``c 3s!@@6nhr!@@+. P?!@@O`Z! 72 `7. 0  Z! @J7@`3P Z!  @@pdc 2 `,3`4`5`6`7` lc pc 7Z! 2 `0 1`B e`P w ` PJ `pd B`@ ` ``0. `0c j` @8IE`@ @@N` [`Td c @c    C+`````D```[`!`f.mN`..0` :`P. `P `@ . ` d mj@` @c6yy``@  @N` [`R &d d @ d  ````[`f.```@XW.e|!I+X@@PN` [`QBd .d P @*d  ```[`f.T`@X0W.p0]!X. ` ``0. `0Ed ]j` @Cof#g`@ p@P@N` [`LPhd Ld @Hd  ```[`f.'%A`pW @lM!&ʇ.kl[!f.PPsap&p.C!&`Z! f.PP:`p V. `@< ` ``T< `0B ;`f /`P. `@0Bg ʢj`  }[`@ p0 @`N` [`Zg Jg `0@Fg  ```[`f.  `@!@ N` [`!tg bg !P!@^g  !````[`f. " "V`0"P". `P"""". `"@#0#xg ^-,j"` "#)z`$@ p@%@`$N` [`%g g `%0%@|g  %`[`f.%%9`".0#@&&. `&P,&&&&.G `&&0'&g j`G &'t%`,(G @+ +P(v(+N`G `*P(g g ))p)@g  )```v(*@*4).@f.**'wA`&(.f.`+`+'wA`&(.f.++'wA`&(.@*@( ``&-,,,,.G `,`n0 `p,0P---P-.G `P----g zj`G -`.-HMU`.@G @0@/N`G ` 0g g 0/@g  @0``````f.00Eܧ`-.6= ` -@1+ `11g+ ``1Ь11. `1022. `22P2. `P2X22. `2n 32. `23p3@3. Y`@333g *@/j3Y` 3P4jbW 0Z`4@ p6P6@5NZ` [` P6h h 65@g  06X`[`f.66o `3.@P8@7NZ` [` P8$h h 87@h  08X`[`f.88/ `3.388. Z`8`9@99. [`999(h j`9[` `9 :",I"\`:@ p@ <@:N\` [` <>h 0h ;;@,h  <\`X`[`f.`<`<Ѹ``9.9<<. \`< =<. X`< Bh / 0 `  p 0 @ P @ P `  p Ѝ p  P @ Ї 0 @ p Ѐ 0   @ ~ ~ P~ ~ `z z y `y y x px x w w t s `s s r pr n n Pn n m `m `i i h ph d d @d b 0b a `W W V pV V U U 0U T T @T S S PS S R `R   p 0@ 0P`p p P`0Pp 0 @P`p0@Pp Ж00@P@Ѐ0|`|xpx xww0wvv@voiPi0edd@d`0]\\T@TN`NGG0GF@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@G `F`G O`0GG d`G HHG. `GpH`Hh Nj H`  HHh{:`@I@ p@L@IN` V`LZl h J`J@h  J(((o`hg*g``gh ``h `.g`^`}`h ``` ` `h `` ` ``````h ``h V`c`f.PLPLl ; Ʈv HpL M.Ll Vwr PjpLN ` MpLMNv Ҕ.MHH`pL ``R`V````````N <``NONN. `NPO@Ol dnJjO` OO2A4` P@ p0RQ@pPN` V`Ql l pQ@Q@l  Q`V`f.RRl %XvO@S@RN` V`Sl l SPS@l  S<``V`f.TTPp`OH/H/@OpT@T. `@TTTT. `T0U Ul jT` TU$3б`e `V@ p@PX@PVN ` V`tPXm l PW W@l  W `````l ` `` `l !````"`#`$`%`&`'`` `V`f.XXm vTpLX[.Ym jVrZ@Z0Y.pY.m =(` 0YYNvNps. Z0{m`0Y*`Z*Z.m )` Z0[NvC>T.p[Fv`Z` `\X\NvNp.@\%V`X `*``` U\\.  `\]  `\]`]0]. +`0]]]m Tj]+` ]@^(`^@ p@``@^N` V`r``m m __@m  ` ``m ``V`f.``\߹`].a``. ,```aPam C3ja,` aaզ$`0b@ p@c@bN$` V`qcm m cPc@m  c`m `$`V`f. d dP`a.pd -`@dd .`de /`de`e0e. 0`0e0ie ffe*y!0i0i0` ief<Φh1`f@ p@h@@gN1` V`Xh0n n @hh@n  ph2`````1`V`f.hho$`e.2`2`Z! .i `Piiii. 3`i@j0j3n rji3` ijʊ7%`k@ pml@`kN%` V`9lFn :n `l0l@6n  l%`V`f.llIn 1hvipL@o@`mN%` V`9o0o fn `n0n@Nn  n`^`}``n o`hg*g4``gVn ``Rn `.g`&````5`%`V`c`f.ooo?`ipL.@p po. 6`opp`Ѐp`p Vj >`  ;=4,?`@@ p@@N?` V`p p `@p  $`?`V`f.  ` .`p@. ?`@. @`0 p aQ:j@` Iƛx<;`@ p@@PN;` V`p p P @p  `;`V`f.-~`. 0. ;`T< `PЈ Q`   `p `@ N` 5``0. A`0Њp njA` @= =`B`@ @ @NB` V` ,t Dq @ p  ;;;o`hg*gC``g:q `2q .g]`D`E``,q (q q `q q N`q q `q `F`q ```S`G`H`Q```I`J``V`K``p `L`t`W`M` `p N``p B`V`n```f.``B)` ..mTt jO` aE2P`@ p@@0NP` V`pt \t 0@Xt  `Q`B`P`V`f.ВВ` R`m @Е`0ДlM!&Pʇ.0kl[!Е0f.sa&p.C!&`Z! Pf.:u u @u  D`X```V`f.`@.Я.@0Cu 7,j` ; |g`@ p@@`N` V`\u Ju `0@Fu  ``V`f.>R`. .P`0plM!&P0ʇ.pkl[!pf.ддsa&0p.PC!&P`Z! f.ее:Ajl` `v/j`@ p@`@Nj` $`q`(y y @y  @h`j`$`f.‡8`. @`lM!&0ʇ.kl[!f.ppsa&p.C!&`Z! 0f.pp:z :z >z  z   >Y`f /`0 ` 5`P 0` x`p  . y` ` P z UF\hj y`   {W "#5`0 @ p@ @ N5` V` 4{ z  P @z    ` `z`x`*``{```5`V`f.P P ]=5` .XP   . 5`    . 1` .@  p  @R M M I H D D @ @ 9 9 5 5 / p/ * * & &  ` @   ` @   7@  .    `  J7@ @  3 P p   ` D{ 0 :{ 2 7`, 3`4`5`6`7` F{ J{ * f. s`pL.f. i{ pvpL7p ` 2 7`7 .     J7` @@ 30 p   @P n{ 2|`, 3`4`5`6`7` v{ z{ f.  s`pL.7  2|`7  ` .    Z!  J7 @ 3  0  ` Z!  @ { 2 w`,@ 3`4`5`6`7` { { 7P Z! 2 w`7  .    `  J7@ @  3 P p   ` { 0 { 2<ˀ9`, 3`4`5`6`7` { { *  f.  s`pL.7 ` 2<ˀ9`7  ` .    Z!  J7 @ 3  0  ` Z!  @ |  3  @  p ,0  | 2 `,@ 3`4`5`6`7`8` | | 7P Z! 2 `7P&  .    `# ! J7@# @ ! 3# P" p!  ! `# w@0" } 2  `," 3`4`5`6`7` } } *% # *% # f.# # }`g`.\ p$ .$ K]`$ 0$ V} |}` p$ % Nv6"bcW.`% `p$ f.% % nON`.\ f.0& 0& 0#`.\7& `# 2  `7* & .&  '  0( J7p* @P( 3@* ) (  (  d} `) Z} 2 `,) 3`4`5`6`7` f} j} 7*  2 `70/ + .0+  `+  . p, J7. @, 3. - ,  - . @- } 2 L`,- 3`4`5`6`7` } } f./ / ]2`.7`/ . 2 L`7@5 / ./  0  p3 1 J7P3 @01 3 3 `2 1  1 p3 ,~ @2 "~ 2<ˀA`,2 3`4`5`6`7` .~ 2~ * 3 f.3 3 m~ [nivpL3 P4 .04 q~ Fvr`  5 3 4 Nv7oh.5 `3 S`]`7p5 p3 2<ˀA`79 5 .5  6  Z!  7 J7`9 @@7 309 p8 7  7 Z!  @P8 v~ 2 `,8 3`4`5`6`7` ~~ ~ 79 Z! 2 `7? : . :  P:  Z! `; J7? @; 3p? > ;  < Z!  @> ~ < 3`> = <  = ,=  ~ 2 `,> 3`4`5`6`7`8` ~ ~ 7? Z! 2 `7`D @@ .`@  @  D A J7C @A 3C B B  @B D <@B  2 D`, C 3`4`5`6`7`   f.@D @D `@p7D D 2 D`7H D .E  0E  @F J7H @`F 3PH G F  F  4@pG  2 N`,G 3`4`5`6`7` $ ( 7H  2 N`7@M I .@I  pI  L J J7L @J 3L K J  K L O@K 8 2G ``,L 3`4`5`6`7` @ D f. M M x`.7pM L 2G ``7R M .M  N  Q O J7`Q @@O 30Q pP O  O Q  PP  2 %`,P 3`4`5`6`7`   * Q f.Q Q s`pL.70R Q 2 %`R =``R R ~`R ]0S S . `S S  `PS S S . v`S T 2= %`S PapT @T . $`@T T `T U N`T `U  `0U U y`U V `U PV ?` V V `pV V L`V @W 4 M`W W W `W . ``W X W  o]jW ` W pX :ӵפ\ `X @ pZ Z @ Y N ` V`Z   Z Y @  PZ ``` `V`f.Z Z  l!vW pL] @] @0[ N ` V`@] n , 0\ \ @  `\ ```)`#``(`{``` ```" `'`=` !` $`v`]``` `V`f.] ] bٹ`W .\ p$ _ `_ @^ N ` V``_ ~ _ ^ @z  @_ ` `V`f._ _ S`W .\ @pa @ ` N ` V`pa a ` @  Pa  `V`f.a a ~C`W .\W b a .  `a `b _`0b b b b . `b Pc *Tc ? zr0c *3 `  d b c NvNM:I.d ( `b ]`3 pd @d . `@d d `d 0e e d . `d e pe Ej0e ` 0e e Px`Pf @ p@h @f N` V`sh ́ g pg @  g `` ``V`f.Ph Ph 0K`0e .pe h ph . `ph h ,/ `h @i *P `i i i `i . ``i j i ρ I'ji ` i pj He`j @ p@l @ k N` V``l  ց l k @ ҁ  Pl  ```{`l )```V`n```f.m m q ` i \p$ H/i m `m . ``m m `m 0n `n n m`Pn n \ `n @o o n . `n o o $ 6Ij@o ` @o p N<;-F``p @ p@r @p N` V`Xr \ , q q @(  q ``V`f.@r @r ۻ`@o .o r pr . `pr r ! `r @s `s s ``s s ``s Pt 0t t . `t t t a ͗jPt ` Pt u \M?`pu @ p@ w @u N` V`S w h v v @d  v ``V`f.`w `w `Pt .t w w . `w x d B`w Px  ` x x  /`px x jc >`x X@y y . `y y y `y . {``y 0Yy -`y @z ]`z z z `z . ``z { z jz ` z p{ A2wI`{ @ p@} @ | N` V`A} } | @  P} ]`^`-`(``V`f.} } } u n} z z 0~ ~ . `~ ~ 1`P~ ~  `~  0 *`~ p l`< `@ 0Y  . (`  +` ` ,`0 ` `Ѐ P B ;`  `p  . ` ` P ٘ /j `  Ђ ',"`0 @ p@ @ N` V`1 P @    ``````)``V`f.@ @ e`  0[p$ P Ѕ . ` ` p `@ `   ` ` 2 `0 V` Ї . `Ї p ` jXWj `  `@ @ p@ @ N` V` ` @  =``V`f. n p$ ` p @ . `@ . '` p$ @ . !` p$  P . "`P p$ . &` p$ ` @  . =` p$  p . `p p$ p$ Ѝ . }`Ѝ P D T` c `p  . `  @  . `  ` . ``  . `  0 . `  P . `P  А . ` h_< ` p  -`@ . ` 0  'uj `  ^=|~z` @ @ @P Nz` V` 4 & P @"  `z`V`f. 7 Ocn Z 0 . z` Z P . )`P 0jЕ . %` p . 7` `Hp @ . `@  |` pL . ` `  P`0  .G `` `` P p  ` g+ `p Z+ e` @ + d` ` . Y``  : ;Uj Y`  p ⮵(,hZ`К @ М p @ NZ` V`p N B @>  P W`V`f. j!V` .@p @ NZ` V`p d V @R  P W`V`f. H` .  . Z` ` 0 . [`0 П h "Cj [`  @ m \` @ @@ @ N\` V`@ ~ p @l  \`W`V`f. s` . Т . \`  . W` f. 0:%v`pL @ @ N` `X@ @  ```f. NYv`& P @ N` `WP @  ````f. à iv`n0 ` @ N` `V` ̃ Ш @ȃ  0 ````f. [gv`I+@` @ N``d`  @  @ ```f. 0u``Pj . ` ` P  b.j `  Ь nr"9`0 @ 0 Ю @ N9` `SЮ   P @  9``f.  !` . @ N9`P` D  P @  7````9``f.0 0 eB` P p p n.б jJ! p`Z! pL @` N9`P`h b ` 0 @H  ]``^ Z o`hg*g``gR ``L `.g7``6`3``D``9``!`f. )` p n.` _J! p`Z! N@@ @ N9``3@ @  """`^`}` `o`hg*g``g ` `.g`=`j?e````f`<`g`;`9``c`&`f. m`` Pj и . ` @ 0 l9*j ` !(& ` @  @` N ` `K ̆ † ` 0 @   ``f. - ֢` .P @` N `P`  Ԇ ` 0 @І   `` `]``F``_````f.0 0 %C` m@ @ N `` 8 p @  п `^`}`2 ```o`hg*g``g( `" `.g ``c`f. Î` PjP 0 . `  _jP ` P  <* `p @ p  @ N ` `;   @   ``f.P P C.`P .0 @ N `P`@ 6 @  `` `L``2 , ( `R`` `^`$ ```a``if.  F`P m@p @ N ``p Ј P @  `^`}`ʈ `o`hg*g``g ` `.g ``c`f. `P Pj  -` P B ` '`p . ` @ 8` " `` >` 0 \ ` d`P m` ` p @ . `@  kj ` P idZxn` @ p @ @ @@ Nn` `& @  @  p n``f. M` . & r + @P @ Nn` `'P ԉ ȉ @ĉ  0 n``f. ` H/@P @ Nn` `(P ܉ @؉  0 n``f. #` " P @ Nn` `)P @  0 >`n`` p f. ! &0  l! @6 p >! @+. O2! @`Z! "@ @` Nn` `*   ` 0 @  >`n``P f.  6V! 0 & p  l!P @6 M!P @+.0 !P @`Z! H/ &0 /0 o0 @ @ Nn`` (  P @  n``f.  + uv 0n@ @ Nn` `+ @ 4 P @0  8`n``f.  C /Kv .@ @ Nn` `, Z L P @H  >`8`n``f. ] ,Ov vp d B`@ =`  ` ` 0 . `0  a j ` @ 3*q` @ @P @ Nq` `P z h @d  `$`q``f. G` . ` 0  $` D T`P *P ` @ . 1` .`   @ ` @ 7 .    J7` @@ 30 p   q@P ~ 2 `, 3`4`5`6`7`  * f. S'a. f.` ` ;~6a `Z! 7  2 `7 .@  p  Z!  J7 @ 3  Z!  @ 2 `, 3`4`5`6`7`  7 Z! 2 `7 ` .   Z!  J7 @ 3  0  ` Z!  @ 2G `,@ 3`4`5`6`7` Ċ Ȋ 7P Z! 2G `7` .   Z!  J7@ @ 3 P p  Z!  "@0 2 n`, 3`4`5`6`7`  7 Z! 2 n`7 .  0  @ J7 @` 3P   @p 2 q`, 3`4`5`6`7`   f. ]2`.70  2 q` jc >``    . ` P @  m:Ej `   fH,b`  @    @p N` ` &  p @ @   ``f.  ` .   @p N` ` : . p @ @*   ```f.  ڸ` "@ @p N` ` L B p @ @>   ``f. ` H/0P . `  p . `p  . ` @  . ` P ` . 9`` 0 . ` 0 jW :` P . `P . ` da  P  P . n`P . q` @ . ` p Ҙ0 `@ r+ `  g+ `  ` 0 . Y`0   Q Tj Y`  @ 0PZ` @  @ @ NZ` `@ d X   @T   ``f.  i` .@@ @ NZ` `@ z l   @h   ``f.  6I` .   . Z` P 0  . [`   ~ ^PjjP [` P  Vp\`p @ @ @ N\` `   @   \```f.P P `P .  p . \`p   . ` Zx Px t t o Pn pn n m m 0m pL L K K 0K J J @J I I PI I H `H H G pG G F F 0F E E @E D D @ @ @@ ? ? : 9 p9 9 8 8 08 7 7 @7 6 6 03 2 p/ , + 0( ' ' @' & & P& & " @"  `   p  @@@@@@@@@@@@@@P `   dB`p  k` @ y`  ``    .` P @ l?j `  ylU`  @0  @p N`` p @ @   ```f. Ë Uin @! @ N``!  ̋ ! P! @ȋ  ! ```f." " ш` ..p" `@" " " " .`" 0# # # j" `" # AZ<|`$ @@% @P$ N``% @ * P% % @&  % ``f.% % C 8{n" # 0& & .`& & `P& & `& ' `& p' 0`@' ' `' ( *P`' ( `( 0( .`0( ( ( F sj( `( @) v6ء # `) @@P+ @) N``P+ N * * @J  + ````f.+ + a|f `( H/+ `+ P, 0, , .`, , , {}:jP, `P, - m)/?iO`p- @@/ @- N``~/ . . @  . ``f.P/ P/ ]~TnP, / / p/ .`p/ 0 0 Dfj/ `/ 0 8[Ci`0 @@2 @01 N``}2 Ό 02 2 @  `2 ``f.2 2 ь wMn/ 3 `2 3 `3 03 .`03 3 3 Ԍ 2pj3 `3 @4 (i`4 @@@6 @4 N``|@6 ܌ 5 5 @،  6 ``f.6 6 n3 6 ĥ D`6 , 7 6 .`6 0 p7 @7 .`@7 7 `7 3 8 7 .`7 `8 `08 8 m`8 9 `8 P9 ` 9 9 `p9 9 f/`9 `: @: : .`: : : > @r  ? ``f.? ? >``: "? !`? @ =`? p@ ^`@@ @ `@ 0A A @ .`@ A pA iP[j0A `0A A Bg`PB @@@D @B N``[@D C pC @  C  ^` ``f.D D `0A "D `D E `D pE `@E E `E F @`E `F _`0F F ~`F G `F PG ` G G `pG G `G @H V`H H ```H H `H 0I `I I +`PI I v`I J ,`I pJ 4M`@J J -`J K `J `K @&&`0K K `K L $`K PL B ;` L L L pL .1`pL .L  M  m f f b b p^ P^ Y Y R R N 7`R @N .`N  N  R O J7Q @O 3Q P P  @P R X@P 2`, Q 3`4`5`6`7`   f.@R @R `"7R R 2`7`Y R .S  0S  ֝W V @T J7V @`T 3PV U T  T V @pU  2`,U 3`4`5`6`7`  " f.V V UYv`..J7@Y @ W 3Y PX pW  W ֝@0X 0 2`,X 3`4`5`6`7` 8 < 7Y ֝V 2`7^ Y .Z  @Z  ] P[ J7] @p[ 3`] \ [  [ ] @\ D 2`,\ 3`4`5`6`7` L P f.] ] }`H/7@^ ] 2`7Pb ^ .^  ^  J_ J70b @` 3b @a ``  ` Jg@ a ^ 2`,pa 3`4`5`6`7` f j 7b J2`7f b .b  c  K0d J7pf @Pd 3@f e d  d K@`e z 2`,e 3`4`5`6`7`  7f K2`7l g .0g  `g  Z! ph J7l @h 3l k h  i Z!  @k i 3pk j i  j ,j  2`,k 3`4`5`6`7`8`  7m Z! 2``m jc>`0m m DT`m @ n m .`m ( Pn n .` n : n pn .`pn pA n n .`n `o @o o .Y`o o o ؎ x"j`o Y``o p YИCZ`p @r r @p NZ`` r q q @܎  r ``f.`r `r ``o .@ t @r NZ`` t  s s @  t ``f.`t `t aP``o .o t t .Z`t 0u u t .[`t u pu  j0u [`0u u =O2V\`Pv @@w @v N\``w   w pw @  w \```f.0x 0x `0u .pu x Px .\`Px x x .`x @G F C 0C ; : ``: : 9 p9 9 8 8 6 6 @6 5 5 P5 1 p1 1 0 0 * * 0* ) @& % % P% %   p      0   @  `  ` @ P P `  P `  p Щ 0 @ `  p @  p И 0 @ p  p 0 `  `~ ~ } p} @@@@@@@@@@@@@} K ?`p} } N `} @~ &O `~ ~ ~ `~ . ``~  ~ A /Sj~ ` ~ p k핬`Ё  @ p  `  @` @pYf. D z(n` ~ @` @ N` `_` pY N @H  P ``````````j?```ps`s````kТ&`~ @  . `  `` . ` ` `0 Ѕ . `   bɚjЅ ` Ѕ S_5x` @ @ @@ Nx` `=  @  @  p ```_```x``f. o`Ѕ H/P  c` _< `p . ` ` @  . `  " I0G7j` ` ` CfJ=w` @ @0 @Ћ Nw` `,0 @ * Ќ @&  `w``f.p p :`` H/ `` 0  . `  p C =dj0 ` 0 L_y`P @ p@ @ Ny` ` J p @F  А ```y``f.P P &L`0 H/ S`p  . ` ` P /%j `  В 4|y`0 @ p@ Д @ N` `Д ֐ P @  ``f.  v+` ..@ @ N` ` ` @ܐ  ``f. ͧZ$` .P p @ . `@ ĥ D`  &] ` @` 0 . `0 B@ . ` ^`И P ` `p ` ` @  . `  6Pj` ` ` Rg-~` @ p@@ @Л N~` `@ >  М @  """`|` `o`hg`g``g ` .g````````````` ^`_``~``g  @f. K \Ztv` hО %O ` i ` p `@ . ` 0 O  p @ @  ` ```g @f.@ @ 0 NSn  @ ` . `` j a` P 0 . `  . ` 0 Ǻj ` ax` @ @ @P N` `7  P @  `````f. # (v Т @  . ` l`` ` P 0 . 1` .p      p P 0    P 0  p P 0  0  p 7 .   Z! 0 J7p @P 3@  Z!  ;@` ( 2 `, 3`4`5`6`7` 0 4 7 Z! 2 `70  .0  `  p J7 @ 3    @ D 2 `, 3`4`5`6`7` L P f.  QJ`".7`  2 `7 .   p  J7P @0 3 `  p @@ f 2 y`, 3`4`5`6`7` n r f. }`H/7 p 2 y`7p P .p    J7 @ 3  P  @ z 2 `,0 3`4`5`6`7`  f.P P }`H/7  2 `7 .  @  Z! P J7 @p 3`  Z!  ^@ 2 `, 3`4`5`6`7`  7 Z! 2 `7 0 .P   Z!  J7 @ 3  0 Z!  L@ 2 `, 3`4`5`6`7`  7 Z! 2 `70 p .   Z J7 @ 3 @  p Z @ ڕ 2 ~`,P 3`4`5`6`7`  7` Z2 ~`7p .   Z!  J7P @0 3 `  Z!  3@@ 2 `, 3`4`5`6`7`   7 Z! 2 `7 .  @  Z! P J7 @p 3`  Z!  p@  2 `, 3`4`5`6`7`   7 Z! 2 `7 0 .P   Z!  J7 @ 3  0 Z!  @ * 2G `, 3`4`5`6`7` 2 6 7 Z! 2G `7 p .   0 J7 @ 3  @  p 0 8@ 2 x`,P 3`4`5`6`7`  f.p p }`H/7 0 2 x`7  .0  `  Z! p J7 @ 3     Z!  @ 2 `, 3`4`5`6`7` – 7 Z! 2 `7p P .p      J7 @ 3  P  (@ ̖ 2 w`,0 3`4`5`6`7` Ԗ ؖ f.P P }`H/7  2 w`7 .  @   P J7 @p 3`    @ 2 `, 3`4`5`6`7`  f.  QJ`".7@  2 `7P  .    Z!  J70 @ 3 @ `   Z!  &@    3 0 p   ,`   2 _`,p 3`4`5`6`7`8`  " 7 Z! 2 _`7  .    Z! 0 J7p @P 3@     Z!  @` 4 2 `, 3`4`5`6`7` < @ 7 Z! 2 `  jc >` p 2 `@   0`  \ ` ` f /`0  ,h 2`  g ` p P  . `  L     . ` h P `   `p  1` ` @  . `   I qhj` ` ` n'^` @ " P" @ N` `#P" P ! ! @L  " `````|```f." " 7lM`` .Т..@$ @ # N` `$ $ # @  P$ ````|```f.$ $ L`` .Т. 0% % . `% % N |`P% % `% & `% & p& @& . `@& & & 6j& ` & P' G3'`' @ @p) @( N` `p) ֗ ) ( @  0) ```|```f.) ) {>`& Т.& * ) . `) `* `0* * 0 *`* + + * . `* p+ `+ ڗ drj + ` + + B6`@, @ p. . @, N` `.  - `- @ޗ  - ```````f.@. @. WTc` + Т.@0 @. N` `0  / / @  / ``f.P0 P0 ҟ` + Т.`+ 0 0 . `0 1 B `0 P1 '` 1 1  -`p1 2 1 1 . `1 `2 P2  e*j2 ` 2 2 H=]1`03 @ @4 @3 N` ` 4 > " 4 P4 @  4 ```````f.05 05 A +gv2 ТP2 5 P5 . `P5 5 `5 6 0 U`5 p6 g 7`@6 Т6 6 . `6 07 7 6 . _`6 7 *Tp7 E Ar&h_` `8 07 8 NvQ)%1.@8 ^z`07 k`` 8 8 . x`8 9 8 . ~`8 P9 9 . ` 9 9 p9 . `p9 9 9 . w`9 p @: : . y`: 0 : `: . ``: : P- `: P; 0; ; . Y`; ; ; I $7jP; Y` P; < kOZ`@ p< @  <  p@ = @p@ @> v> p@ P> 4> .N @NZ` `@ > j ^ ? ? @Z  ? ``f.P@ P@ e`P; .f.@ @ m 7vP; A @ @> @B @pA NZ` `B v pB @B @r  B ``f.C C @{`P; .; `C 0C . Z`0C C C C . [`C  D D J6jC [` C D 8Ƀ\`D @ @F @@E N\` `F @F F @  pF \```f.F F |`C .D G F . \`F pG @G . `@G P`G P"<I 638P5>U2-O&^lm<ˀ2|n)*C+t0 pprp`P`F0 @ q  E 7 J `G L pL (K lm<ˀ)pP `uj9P5>U#dMk 0E D pA A ; : 9 P9 9 8 `8 8 7 p7 7 6 6 06 @ `  p 0 @ `  p 0 @ `  p `  p 0 `  @ @ P  `  p Р 0  P `  P ~ P~ ~ } `} } n @n m pj j f a ` P] 0Y X X U Q @Q P @@@@@@@@@@ Q J `P pQ J `@Q Q Q Q .J `Q 0R R Ø UpjQ `J Q R &Gd`S @J @T @PS N`J `T ֘ ʘ PT T @Ƙ  T ```f.T T T ؘ JΑnT Q `U @U U .J `U U U ۘ M j`U `J `U V E3*D `V @J @0X @V N `J `0X W W @ޘ  X `` ` ``f.pX pX nO``U .X J `X Y J `X Y `Y 0Y .J `0Y 0] Y  Z Z Y !0] 0] `J ] Y Z Y%`Z @J @\ @@[ N`J `\ $ @\ \ @  p\ ` ` ````f.\ \ oL`Y .``Z! .] ] P] .J `P] ] ] ' _j] `J ] `^ . ` _ @*  @`  ```f.` ` qS`] .] ` ` .J `` `a @a a .J `a a a B ej`a `J `a b rX5D`b @J d d @b N`J ` d d J c c @F  d ```f.`d `d َ``a ...@0f @d N`J `0f z n e e @j  f ``f.pf pf 7f``a ..f f f .J `f @g 0g ~ Yjf `J f g 1`h @J @i @`h N`J `i `i 0i @  i ````f.j j `f .Pj J ` j j j pj .J `pj k k Qjj `J j k LP"vT`k @J @m @0l N`J `m 0m m @  `m ````f.m m `j . n J k`m pn J `@n n n n .J `n 0o o ~ejn `J n o 2i`p @J @r @Pp N`J `r : Pq q @  q U``r `7``T`6```````D`f.Pr Pr ``n r pL| r | r | r { .{ s ^!| | Ps | pz .s A _>Trx w w w w s &v t F ʆb0t @u .u I ErR=@&t pt M §]NbR=@6Pu t 6'np`R=@+.0u o?9`t .`J v 0t 0v Nv2%1.pv `0t T``7``6 w w /H`0t @+.`w ;ڒ`0t @*Ps *Ps & x x P &̪bPs @6x `x _/`Ps @+.x `Ps @*y y .@y S Qsr`y *g `J Pz y y Nvwbד]1.0z ῵`y (`!`"`J @{ Ps z Nv<y. { di8`Ps #`$`%`&`'``| | | (`J | r | Nvp㉏.`| R|z`r )`*``+` `Z! .b`Z! .`Z! . o @} } .J `} } J ``} } } .J `} 0~ J `~ ~ J `P~ ~ ~ ~ .J ,`~ @ 0 W Oj~ ,`J ~  7K-` @J  @` N-`J ` r b ` 0 @Z  -`^ `f. x `~ r ..@ @p N-`J `y z p @ @v   #` `+```.`-``D`f.P P 84`~ r ... J N` 0  .J /`  p s~?hj0 /`J 0 jb˵wz'0`P @J P @ N0`J `b Қ ƚ p @š  Ї `0``f.0 0 ֚ :pv0 pL@ @ N0`J `d ޚ p @ښ  Љ N`0``f.0 0 H``0 mp P .J 0`P Њ .J 1` @ 0 orj 1`J ]1K2` @J  @` N2`J `a  ` 0 @  `2``f.  "v pL@ @` N2`J `c   ` 0 @  N`2``f. ` m0 @  .J 2` J 3`` J 5` 0 J 4` J @`P Б .J 5` @ 0  Jqj 5`J b6` @J @ @` N6`J ` 4 & ` 0 @"  #`6``f. C?` .` @  .J 7`  7 C.j` 7`J ` xia` @J @ @Ж Na`J ` R B З @:  > a``f.` ` -C`` .. .J 8` 0 U j 8`J hp9` @J @ @P N9`J ` j \ P @X  T`9``f. m` .P 0 .J :`  m yjP :`J P  ;C̎\z!6`p @J @ @ N6`J ` t @p  ` 8`7`;` 5`$`6`3`%`#`!`&`'``D<`X<`F`f. NZ`P Ps ... ` 0 .J 6`0 J =` J ``Р P J ` J `p J .` @ J V` J m`` .J >` P @ ,j >`J z3` @J @ @p N`J ` Μ p @ @  #```f. cڰ` .p P .J ?`  ќ !\jp ?`J p 0 S ` @J @0 @ N `J `0 ؜ @Ԝ   #` ``f.p p $`p . .J @` 0 |Ӎj @`J xK\q` @J @ @P N`J ` P @  #`!```f.  ` .` @  .J A`   mm/j` A`J ` `=``D<`X<`F`f. <{M`P Ps ... 0 .J .` J `P й iJ ` J ` p J F`@ J ` 0  .J G`  p hVj0 G`J 0 2kc-H`P @J @ @ NH`J ` ȟ p @  н `H``f.0 0 }U`0 ..p .. ͟ jp I`J p 0 # j=;` @J @0 @ N;`J `0 ԟ @П   H`;``f.p p I_`p ..p .J H` p .J I` p @ .J ;`@ .J J` 0 j J`J 6uH*h#` @J @ @P N#`J ` P @  K` `#``f. >` . @  .J #` J `` J L` P 0 .J M`   XrjP M`J P  n+K`p @J @0 @ NK`J `0 "  @  L` ` K``f.p p `P . .J K` Ps  .J "` ` J +`0 J ,` 0J *` P \ J ` 0t p .J `p J ?` @ J ` J `` J -` P 0 .J N` g&  @ jJ a`p gJ 7` @ J /` fJ /`` y .J ` P 0 .J O`  * 7QjP O`J P  [9U/P`p @J @ @ NP`J ` X 2 @.  Q`X``P``f.` ` ujt`P  . . ] ;j R`J tʱS` @J @ @0 NS`J ` v d 0 @`  ` P`S``f. ,` . . 0 P p @  lM!& ` ʇ.@ kl[! @ f. sa & p. C!& `Z! ` f. :纜U` @J @P @ NU`J `P @|  Q`X``U``f. ;[H` @ . .@ 0 8+j V`J H8'W` @J @ @` NW`J ` Ġ ` 0 @  U`W``f. u` . .P ` 0  p  lM!&P 0 ʇ.p kl[! p f. sa &0 p.P C!&P `Z!  f. :`06 6 J P`6 7 6 .J Q`6 U P7 7 .J ` 7 a 7 p7 .J `p7 0g 7 7 .J `7 k @8 8 .J `8 0 8 `8 .J -``8 r 8 8 .J (`8 09 9 .J S`9 0 9 P9 .J W`P9 9 9 9 .J ^`9 0: .`^`J 9 Nvԩ}: : : .J ]`: 0; .w`]`J : NvྂP(T; ; ; .J Y`; @< 0< a gj; Y`J ; < v5FZ`= @J ? > @`= NZ`J `> `> 0> @  > ``f.> > f]<*`; .@@ @`? NZ`J `@  `@ 0@ @  @ ``f.@ @ ڑR`; .0< PA A .J Z` A A A pA .J [`pA B B $ !njA [`J A B 3k3L.\`B @J @D @0C N\`J `D : , 0D D @(  `D \```f.D D F`A .B E D .J \`D J `E 0E .J `0E _`G 0G G E lm<ˀ pPF*7)WX9P5>Uzm0B > Z ` М 0 @ P P p Ѐ 0   @ ~ ~ P~ ~ } `} } | p| | { { 0{ z z @z y y Py y x `x r Pn n m `m m @e d d Pd d c [ [ W @S R R PR R Q `Q Q L L @L K K PK K J `J J @@@@@@@@@@J E `J J E L``J J E ?`J 0K E >`K K E `PK K E `K L E V`K pL E m`@L L E `L 0M M L .E ``L M pM O ީj0M ``E 0M M B|Uoa`PN @E p@P @N Na`E b`P J Z O pO @R  O ``q`pP `c`\``>`V d`R```"`n`a`b`#`X0`e`f.P P ``0M mN..@Q E `Q pM Q `Q .E a``Q Q E <`Q 0R E f`R R E `PR R E `R S E A`R S pS @S .E $`@S pW S PW S PT 0T T f !pW PW pW PW $`E 0W S T tjJ%` U @E p@V @pU N%`E b`V X pV @V @T  V g``%`b`f.W W +Ȅ`S `g`g`Z! .`Z! .W W W .E h`W 0X X ]jW h`E W X 0 b b @,  c l`k`b`f.c c c`@\ ..c E l`c 0d :E `d d _OE `Pd d E ,`d \ e d .E k`d e pe @e .E m`@e e e B !/zje m`E e Pf sDOG l`f @E ph Ph @g Nl`E b`dPh x J h g @F  0h k`l`b`f.h h P2`e ..k pj @i Nl`E b`ppj j i @~  @j l`s`l`b`f.j j `e .j *L@l @Pk Nl`E b`ll Pl l @  l l`b`f.l l `e ..@m E 0`m m E J``m e m m .E l`m 0n PE `n n n Pn .E n`Pn n n 17*jn n`E n `o s{l͋o`o @E p@q @p No`E b`Wq q p @  @q  `q`l`J``p`"`o`b`#`f.q q erq`n mpL.`r @r r .E 1`r .r  r  @x s 7x s .t  0t  w @u J7w @`u 3Pw v u  u w E @pv  2E q`,v 3`4`5`6`7`   f.w w  `m70x w 2E q`x E =``x x E `x 0y E `y y E `Py y E 1`y z E _`y pz E q`@z z E `z { E `z `{ E w`0{ { E x`{ | E `{ P| E ` | | E `p| | E \`| @} E `} } E /``} } jcE >`} 0~ E 9`~ X ~ P~ .E i`P~ ~ E k`~  E 9`~ p E `@  E :`  E ` ` E 1`0 E ` E `Ѐ P E ` n p .E o`p  .E r` 0 0  P p Ї Ђ  P  <\8K!0  Ї 0  Ї r`E P  MtlW`` @E @ @ NW`E s` r @V   o`hg*gt``gf `` .g` `9`V`u`i`v``w``x`"`y`Z 9`W`s`b`#`f.0 0 K^` u``v`V`x```Z! .x`Z! .V`Z! .v`Z! .`Z! .u`Z! . P .E z`P  ` NEP!  z`E P 0 }5K>` @E p@ @ N>`E s`  @   `v`o``{``|`"`o`hg*g}``g ` .g:`>`s`b`#`f.0 0 Yo` `|`v```Z! .v`Z! .|`Z! .`Z! .P 0 .E ~`  gjP ~`E P  `p @ E @ @ N`E b` d  @   888`]`R`o`hg*g``g ```.g` ` ``x``q`` ``1`z`j?e````f`g`r`:`9````t`_`` `  T`X````b`&`~q`T`X```f.0 0 ` P . .. m Г Aj `E P (q` @E p@P @ Nq`E b`P ʲ Е @  0 `q`b`f. Q` m Ж  0  p lM!& ʇ. kl[! f.@ @ sa` & p. C!& `Z!  f.@ @ :U puZ      @   P  p   P     P @ P ` P `  `  p P  @ P `  p 0 @ P `  p 0 @ P `  p p p г 0 @ P @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@0 ` `P Э ` ` p `@ l` 0  . `  p % _fj0 ` 0 j^(e`P @ @ @ N` ` 8 P p @(  б l````L o`hg*g``g@ `: `.g6 `0 `, `V````f. G`0 ...` [`0 ` ~`г P _` p . `p  H ^тj ` 44;yW` @ @ @0 N` ` ~ 0 @L  ` p j P ``f.з з R5` ..P 0 . `  |{jP ` P  .`p @ p@P @ N` `P 2 @   C+``t0`[`````f. `P * *I+0*fP ,/ ` p . `p  . ` ` P = ʫ1j `  н [X`0 @ @ @ N` ` j L P @@  `H D ```f.0 0 ` )... p . 1`p .    7 @ .`   J7 @ 3   @  @ t 2 `, 3`4`5`6`7` ~  f.@ @ ` ` * *I+0*f7  2 `7` @ .`   J7 @ 3   @  5@ 2 `, 3`4`5`6`7`  f.@ @ ]2`.7  2 ` d B` @ =` `` -` 0 ` 9`P Q` 2` p .`@ `  ` ` \`0 ` ` P A` `p ` @ ` _`` <` 0 ` `P ` ` p `@ P . `  V` ` `0 ` _` P ` `p v` @ D) ` 5`` 0 *` 0  /` jc >`P 4 M` y` p p @ . `@ . `  ` @ j!  ` "'dB`P @ @ @ N` `<  ޵ p @ڵ   `X````````f.` ` ؝&c` .``Z! . . ` 0  p Ng!  ` `  Sdǭ^` @ p@` @ N` `<` ̼ T @   XXX`X````P U`````J o`hg*g``g> `6 .g_`2 ````@ ```t``` ` , T````<``( $ ```S` ````V`\` ```.``2`` `Q`` ` a``9```D```!`nW```DW`D`~q`T`X```XW``f. `  .f@ . . 0 P p @  lM!& ` ʇ.@ kl[! @ f. sa & p. C!& `Z! ` f. :` @ @ @0 N>` `i r L 0 @H  ` ```v``>``f. Zq`` .v```v`Z! . P . `P  w 5j ` ` 7>,VT` @ @p @ N` `;p ~  @z  @ ````f. q*` . ` :` P U @` i `p 2* F` @  ` t`` . ` a @  . ` k`` @` 0 ` `P . ` @ 0 Rj ` †N }` @ @ @` N` `! . ` 0 @   `` ` ``f.0 0 $` ..0 ` . `` l .` 0  ` r] L`P ]< ` ` p N `@ . ` 0 2 j ` >m%` @  0  @ @ @@f. 5 7)Gun  @ @P N` ` @ J P  @8   777`F @ `B `L`> ``Z`ZZPm`vs`R` #D]A```e``ڨnڷ`h``ts^8‡`````````|````D`  P . `P  f /` @   . ` Yp    . `    }j `   \gi` @ @ @@ N` ` ʾ @  @  p ````f.  Gj` " 0  . `  `P  1` @  . `  ; tpRj@ ` @ ?|&ܶ`` @ @ @ N` `  ؾ @о  Ծ ```f.P P `@ .. . ` ` P  $` p . `p   Ouj `  ֌W>\` @ p@ @0 N` `  ( 0  @  `   ``f.  4t` " 0  . `  , `P t0  . ` C+   . `  p @ . Y`@   + j Y`  P ޑFZ` @ p P @ NZ` `P > 2   @.  0 ``f.  I` .@P @ NZ` `P T F   @B  0 ``f.  ;` .   . Z` ` @  . [`   X Rj` [` `  }@\` @ p@  @ N\` `  n `   @\   \```f.` ` 88`` .   . \`   . ` `G   X lm<ˀ*C+t0Z2 pq XS9P5>Uz h.T/b r Zp `p l l g f f b b Pb p^ X O K 0K J J @J I I PI I H `H H G pG G F F 0F E E @E D D PD D C `= P/ / . `. . - p- - , , ( ( @( ' # # 0# " " @" ! ! P! ! @@@@@@@@@@@@@@@@@@@@@@@@@  ` 0!  /`! !  `P! !  +`! "  `! p"  q`@" "  w`" #  `" `#  `0# #  `# $ $ # .  `# p$ `$ j $ `  $ $ ˚;z`@% @  p@' @% N`  `^'  & `& @  & ````2`S` ` `q` V` `T` ```f.' ' ~Ѿ` $ .. (  5`' p(  `@( (  `( 0) ) ( .  `( ) p)   j0) `  0) ) v`1c`P* @  p@, @* N`  `X, F " + p+ @  + V`````f.@, @, _g`0) ....,   2`, - T<  `, P-  ` - - 0n  `p- - `<  ~`- @. x0  `. . (+  ``. .  `. 0/  `/ / / P/ .  `P/ / / L O^j/ `  / `0 #`0 @  p2 p2 @1 N`  `Vp2 d T 2 1 @P  @2 S````f.2 2 g yv/ `4 4 @ 3 N`  `U4 p 4 3 @l  P4 k````f.4 4 X+v/ 6 6 @05 N`  `R6 06 6 @  `6 ```f.6 6 r>Cv/ J} 8 8 @07 N`  `Q8 08 8 @  `8 ` ``f.8 8 o.v/ 8‡; : @@9 N`  `O: @: : @  p: ````f.: : x`/ .@< @P; N`  `P< P< < @  < ``f.< < `/ = *Pd = * +@= *Db0= = `= .  1``= .=  >  C ? 7PC 0? .P?  ?  B @ J7B @@ 3B A A  0A B  @A 2  `,B 3`4`5`6`7`  f.0C 0C ]2`.7C B 2  `C d  B`C 0D  =`D D jc  >`PD D  `D E   -`D pE  t`@E E  e`E F  ,`E `F  `0F F P  `F G 0  *`F PG   ` G `$ G pG .  `pG G  `G @H  `H H  ``H H  `H 0I  `I p) I PI .  `PI I  k`I J  `I pJ  `@J J  `J / K J .  `J `K  `0K K K K .  `K O K pL PL 0L q!O O `  O K L >+<`@M @  @ O @M N`  ` O f N `N @b  N O `````X``f.`O `O k`K pL``Z! .P O O .  `O X 0P P P pP a Q!X X `  W P Q _&R`Q @  @T @Q N`  `T R R @   S ````````,`e``o`hg*g``g ` .g ``S ```X``f.PT PT ,` P ..T K pLW T W T W U V 0U V pU lM!&W V U ʇ.U kl[!W V f.@V @V sa`V &W p.V C!&W `Z! W f.@W @W :`pZ @  @@] @Z N>`  `3@]  [ [ @  [ (((`v```````````o`hg*g``g ``  `.gV```` ` ` ``` >``f.] ] 7`pX ..```v````Z! .v`Z! .`Z! .`Z! .^ ^ p^ .  `p^ _ _ 9j^ `  ^ a _ s~1`_ @  @a @0` N`  `a 0a a @  `a ````f.a a yۮ`^ ..0b 9`^ b 2*  F`Pb b F  `b @c c b .  `b c c [wj@c `  @c d z_u"``d @  p@f @d N`  `f e e @  e ``f.@f @f kB!`@c `f .c f f .  `f _ g f .  `f pg Pg g .  Y` g g g j7jpg Y`  pg 0h Z`h @  j 0j @h NZ`  `0j i i @  j ``f.pj pj E`pg .@0l @j NZ`  `0l  k k @  l ``f.pl pl ql`pg .g l l .  Z`l @m m l .  [`l m m  liZj@m [`  @m n 'm\``n @  @p @n N\`  `p (  o o @  o \```f.@p @p q&`@m .m p `p .  \``p  p p .  `p `G r r 8q lm<ˀ pՀ S9P5>Uz]_ ,   0 `  0 ` `} } | p| | { { 0{ z z @z s s @@@@@@s q `s @t t s .q 1`s .`t  t  z u 7y u .u  v  y w J7`y @@w 30y px w  w y q @Px 2 2q `,x 3`4`5`6`7` < @ f.y y ]2`.7z y 2q `pz dq B`@z z q =`z { jcq >`z `{ q `0{ { q _`{ | q 2`{ P| q ` | | q `p| | q `| @} q `} } } `} .q ``} @ } P~ 0~ ~ T4!@ @ `q } ~ 0r~b`  @q @ @p N`q ` f T p @ @P  ```f. .ei`} .``Z! . ` .q ``  Ё P 0  j!  `q ~Ԅ[` @q @0 @p N`q ` 0 n p @ @j    ``R```S`T`U`2```n```f.p p /]` .. } .Ј @  lM!&Ј  ʇ. kl[! f.P P sap & p.Ї C!&Ј `Z!  f.P P :4` @q p@P @ N`q ` P @  ````f. fh;` .. }@` @  .q ` ` .q Y``  rl j Y`q p zEslWZ`Ў @q pА p @ NZ`q `p  @  P ``f. g,` .@p @ NZ`q `p  @  P ``f. N@K` .  .q Z` ` 0 .q [`0 Г  *5 j [`q @ p-\` @q p@@ @ N\`q `@ 2 $ @  \```f. ` . Ж .q \` q .q ` `G x lm<ˀPp*3o:Q9P5>UpVj=' 6 @@@( P ` в 0 0 @ P `  p С 0 @ @@@@@@@@@p @ `@ .@ 1` .  0  @ 7 ` .   J7 @ 3П  0  `  @ @ @ 2@ `,@ 3`4`5`6`7` J N f.` ` ]2`.7  2@ ` d@ B` ` @ =`0 jc@ >` @ `С P @ ` @ `p @ ` @ @ ` @ `` @ ` 0 @ 2` @ `P Ф @ ` @ ` p @ \`@ @ `  0@ *` ` 0 .@ `0   E!  `@ h׏` @@ p@ @@ N`@ ` t b @  @^  p  `` `f.Щ Щ l` m ` `Z! . ` 0 .@ `0  '!  `@ k ` @@ p@Ю @@ N `@ `Ю @  @x  p  ````2` `]`R```ot`hg`g``g ` ` | T`X``.g`;` ` ``T`X````D`f.  "}` .` mp P 0 0 lM!&p P ʇ. kl[!0 f. sa &P p.p C!&p `Z!  f. :`P @@ p@@ @ N>`@ `@ p @  ж  `````>` `n```f. kWD` .``````Z! .`Z! .`Z! .`Z! .`Z! .и .@ `   ,jи `@ и aSإW` @@ @ @@ N`@ ` @  @  p  ``` `f. `и ..@ 5 `и i@ ``  .@ ` 0 p@ ` P .@ Y`P   ͉Ej Y`@ ` )4:ZZ` @@  ` @ NZ`@ ``   @  @ ` `f. 9` .@` @ NZ`@ `` ,   @  @ ` `f. O ` . .@ Z` p P .@ [`  0 jp [`@ p 0 #,\` @@ @0 @ N\`@ `0 F 8 @4   \`` `f.p p ?1`p . .@ \` @  .@ ` `G h lm<ˀ|n*)`pfO9P5>U?jS J @@@(P@ @  `  p 0 @ P `  p 0 @@@` 0 `0 .0 1` .   0 7p P .p    J7 @ 3  P  0 @ T 20 `,0 3`4`5`6`7` ^ b f.P P ]2`.7  20 ` d0 B` P 0 =` jc0 >`p 0 ` @ 0 ` 0 `` 0 ` 0 0 ` 0 `P 0 y` 0 ` p 0 .`@ 0 `  0 ` ` 0 `0 0 @` 0 ` P 0 ` 0 `p P0 ` @ 0 k` 0 `` .0 `  ` OZ&!  `0  "k^>`p @0 @ @ N`0 ` @  ````f.` ` ` pL``Z! . .0 ` p 0  p 큱X!p p `0 P  '5\` @0 @ @ N`0 ` @  `X` ````` `` ``````````f. TM}` .` 0 pL@ P p `  lM!&@ ʇ.` kl[! ` f. sa & p.@ C!&@ `Z!  f. :` @0 @p @ N>`0 `$p  @  @ (`0`>``f. ]X`P .0`0`Z! .` @  .0 1`   zcj` 1`0 ` _<` @0 @0 @ N`0 `0 " @  ````f.p p ۜz`` .. [`` .0 ` p ` p .`.`p 0 .`@ 0  .0 ` ` P P ` P Y  ( ?@ @Uppp@?Vj@@ .0 Y` ` P + ̵j Y`0  _}ը(Z`0 @0 0 @ NZ`0 ` > 2 P @.  ``f.  aN` .@@ NZ`0 `T F P@B  ``f.` .P p@.0 Z`@.0 [`0 X j[`0 Ȣ3 _\`@0 @@PN\`0 `n ` P @\  \```f.3^5`. 0.0 \`0 P.0 `P2`G P  lm<ˀ2)*p p63N9P5>Uzc-0R r @@@<F0FBpB<<P<< 8.*P**)`))(p( (''0'&&@&%%@%$$P$$#`##"p" "!!0!  ` p   @ @@@@@@@@p `@    .3` 0  { < Fj 3`  API4` @@ @P N4`5`Z  P  @~  6`4`5`f.  `  *P B$`   /`p  f/` @t```.)`P@ mLj)`cT)86*` @p@@pN*`F` p@@  `*`f.at`.pP .7`  Ljp7`p0dl8`@@0@N8`5`O0 @  )`8`5`Pf.|vap`Z! . .1`.@ p   7.   `J7@@ 3Pp ` @0 29`,3`4`5`6`7`  f.]2`.7`29`7 @.`   J7@3 @ U@ 24`, 3`4`5`6`7`  f.@ @ `` *7  24`!dB` `!=`0!!!.8`!"`!P"` ""`p""jc>`"@#`## ``## `#0$v`$$n`P$$`$ %5`$%p%@%.6`@%  %`% &1`%p& `@&&`&'`&`'q`0'' `'(`'P(` ((`p((_`(@)`))k``))@`)0*`**`P****.:`*.++p+P+a*9U!..:``.*, eҋ;``,@@.@,N;`5`.8 & --@"  -<`;`5`f.@.@.JH`*.<`<`Z! .....=`.8//p/P/w"\!88=`7.0% q>``0@ p@4@0N>`5`4 11@ <  1AAA`X```` o`hg*g?``g ` .g_` ` ` `q```@` ``` ` ~ `z v 6`r n h d n`T`` `\ X T P ``H D @ 8`3`>`5`XA`u`f.P4P4j~` ...4*.7474756056p5lM!&765ʇ.5kl[!76f.@6@6sa`6&7p.6C!&7`Z! 7f.@7@7:Puv#HZ``>@p`@@@>NZ`5`@ ??@  ?2`5`f.@@@@1O`@=.@B@@NZ`5`B AA@  A2`5`f.@B@Bq`@=.=BpB.Z`pBCBB.[`B`CPC j%8jC[`CC$vR\`0D@@E@DN\`5`E EPE@  E\`2`5`f.FFdq`C.PC`F0F.\`0FFF.2`FC`G HPHGlm<ˀ)*p:L9P5>Up//  @@@<P0@`}`xokPkk0ihh@hggPggf`ffepe edd0dcc@cb\0YXXUT`TT`PPOpO O`KKJpJ@@@@@@@JF`pJJF/`J@KF5`KKK`K.FD``KLK KLjKD`FKpL_8J3UE`L@F@N@ MNE`FF`[N < NM@  PN  8 G`4 0 , ( $ E`F`f.NNq`K...POF@` OOF_`pOOF~`O@PD)F`PPP`P.FH``PQP K jPH`FPpQ!CXI`Q@F@S@ RNI`FF`RS SR@  PS  ` ` I`F`f.SS ZvP)@TF `TTFm``TTF`TPU0UU.FJ`UUU PjPUJ`FPUVOK`pV@F@ X@VNK`FF`L X"  WW@  W`K`F`f.`X`X˹`PU..XPJF`XYF`XY`Y0Y.FL`0YYY& .OjYL`FY@Z[XJM`Z@F@@\@ZNM`FF`A@\D . [[@*  \R`M`F`f.\\gF+`Y.\\\.F1`\.] @]  bP^7bp^.^ ^  0b_J7b@_3a a@` p`0bF @aH 2FN`,Pa3`4`5`6`7` R V f.pbpb]2`.7b0b2FN` cdFB`bpcF=`@ccjcF>`cdF`c`dF `0ddF`deF`dPeF` eeF~`peeF`e@fFT`fKf`f.FE``ffFO`f0gF`ggF`PgPgg.FI`g h0F*`gphF`@hhFk`hUih.FK`hi`i0i.FP`0ieiejji2d Y@jt p j f v 0kF `kkF `Pkkkk.FQ`kollplPl!ooQ`F`okmdxhR``m@FK@o@mNR`FF`o ~ nn@z  nS`R`F`f.@o@o2ET`k.S`S`Z! .ooo.FT`o@xppppPpdo!@x@xT`F xoqE(E$W8U``q@ Fp@Pt@qNU`FF`PtH rr@   r'''```X`I``` O`T`S`E` ``` t`````o`hg*gV``g ` `.g` U`F`~qX``W```f.ttYI` o..tk.xuw0uwPu wpuvulM!&x@vuʇ. vkl[!w wf.vvsav&wp.wC!&x`Z! @wf.ww:`z@F@p|@zN>`FF`*p| x {{@d  |  t P`X``X`K`T`p l h >`F`f.||k `x.T`X`X`X`Z! .X`Z! .T`Z! .}}`}.FY``}~} 7j}Y`F}p~p&ҟN`~@F@@ NN`FF`  @  PT`Q`N`F`f.Y|`}..  _`}pF`@2*FF`Y.FM`}`0.FN`0Ђ.FY`  AbjЂY`FЂZ`@F@@NZ`FF` @@  pC`F`f.ЅЅ2`Ђ.@@@NZ`FF`  @@  pC`F`f.ЇЇ7`O^`Ђ.0.FZ`P.F[`P ȯj[`F`4!\`@F@`@N\`FF``. @  @\`C`F`f.QF`..F\`F@.FC`Z`G lm<ˀ)* p <~K9P5>Ul%0 2 @@@<P0@P`@Н0@P`p И0@P@@@@@@@@@@@@@@@0``P.`1`P.   7@ .@ p  J7@3Д `@< 2`[`,3`4`5`6`7` F J f.  ]2`.7p2`[`Жd`B` `=`pjc`>`@```0```q`0````ИP`1` ` `p``@`2``\````0`s```PЛ`V` ``p``@``D)```f`/`0`` Н.`]`Н@WH!]`` 0yd^`@`p@@@N^``_`@| d @`  ```d`^`_`f. #` )..````Z! .P0.`a`ppТQ!ppa``PP`cӶlb`@ `p@p@Nb``_`pr @   @`c`P````@``s`` \`d`2`V``e``R```q`b`_`X`f`D`nX``W`f.藅` P...  )..0@`PlM!&0pʇ.Pkl[!Pf.saШ&p.0C!&0`Z! pf.:V>`@`p@@`N>``_`  `0@  `f```v`>`_`X`f`f.@@x-`f```v```Z! .v`Z! .`Z! .`Z! .f`Z! .p@.`g`@а jg``Pu%E[`@`p@`@N[``_`` в@  0a`]`[`_`f.`.U`@`@```~`````0`` `/`Pе.`h`@0 5;jh``hg<c`@` @`Nc``_` `0@  `c`_`f.`..0@pNc``_` p@@  c`_`f.f" `0M.@м@Nc``_` м  P@  `c`_`f.v%`.0p@.`c`@а.`[`P`d``P``0о.`Y`  ;LjоY``оj%'Z`@`@@NZ``_`&  @@  pZ`_`f.[(`о.@@@NZ``_`< . @@*  pZ`_`f.`о.0.`Z`P.`[`P@ ݛ*j[```zD/U\`@`@`@N\``_``V H @D  @\`Z`_`f.)`..`\``@.`Z` `G  lm<ˀ|n)* p99P5>U p:˘ы Z @pp 0@0p 0@p ЏP`~p~ ~}}0}||@|{{P{{z`zzyss@srrPrrq`qqmPmml@ih`eedpd``P``0UTTROOHpH HGG0GFF@FEEPEED@A@@P@@p: :02.`.**0*&@! P@ P0   0 @``0P`p 00@`@`p@@@@@@@@@@@@@@@@@@@@@@@@@``p.`i``P 1Nji``Tw!. j`0@`@@Nj``k`(n P@  l`J`|`m` j`k`f.@@DY`.`.`n``t լ$jn``pB @@  p(((`` `z`/`7` )`"``o`hg*g``g `(` `.g`%`` ``"``=``k`#`D`f.` o%v` )@@N``k`> l `@h  |n```k`f.00 lv` )2*`F```L`P0.`` jP``P ef`p@`@ @N``k`)  @  7`L``k`f.``V`P ..``0  [j``.a,u`@`@@PN``k`$ P @  `k`f.o3h+`.. @.```.``` 6j``p)x!ΌG`@`@@ N``k`8  @  P!`*```k`f.QG` . .``p@.``@.``0 < 0 j``^l-X4` @`@ @P N``k` \ D P  @@  ``'``k`f.  ʑ/0` .. ` 0 .``0  ``  `` p P  .`$`      $!$``p  6%` @`@@0N%``k`x f 0@b  ``/``%`k`f.BY`p ``Z! .```0`1` .``p`z |>j `` /[-e`@@`@@N``` `@~  ```f.00!` .ĥ `D`P.``&X pP .``  )jp``p0:@f5`@`p@@@N```@ @  ````f.8a7`p.`m` ``p``@``0.`)`p j0)``0S~ *`P@`@@N*``F` p@  `*`f.00y`0.P.``P =Vj```<7ktn`@`p@ @N```   @  @ `)```m```f.  ! v !`^` !p!@!.``@!!!% ej!``!P"c0|Kb`"@`$`$@#N````$F , $#@(  0$^```f.$$I n5v!@`&@%N````&` R &%@N  @&``f.&&;G`!.'&&.``&`'P'c j'``''*bN`0(@`p@)@(N```x)N j )P)@f  )``f.**T D v'`*``0*P'**.``* ++*.``*p+`+X M|j +`` ++A-E>4`@,@`p@.@,N```o. d -`-@\  -`p``` ``f.@.@. v +.`%``./...``.P/@/ +Vj/``//g7 ` 0@`@1@p0N```i1 p1@1@  1|n```f.22d;`/.2`202.``0222 =e/j2``2@3 ,`3@`65@3N```P5l 44@  5  `` k`5`J`````D`f.55t 'hv20M87@`6N```P7 | `707@x  7``f.77 ?v20M@9@`8N```f9 `909@  9```f.99Db`2..2P: :.`` :::p:.``p:;; eɺj:``:;xZZbW  `;@`p==@0<N ```K= 0==@  `=`` ``f.== 'ev:pL@?@@>N ```J? @??@  p?`~` ``f.?? :{v:N0@``@@`~`P@@``@ A``@ApA@A.``@AAA qrjA``APBɹr,#p`B@`p@PD@CNp```9PD DC@  0D`p``f.DDM `A.ADD.`p`D0E``EE``PEE``E F`.`EpF``@FF`r`FG` `F`G`J`0GG``GH``GPH`` HH```pHIHH.``H`IPI dJjI``II 4,|~`0J@`M M@JN~``` M~ F KPK@  K***``B k`M`J`|```r``-`> +``: `6 `2 `. '`* (`& !`" &` #`|n``"`` 7`~``D`f.`M`M "vI0M@ O@MN~```7 O NN@  O`~``f.`O`OU>`I.PIOO.`~`OQPO.``O@&` PR Qr9 9 'N&9N&9N&&N&>&N&.&@Pf.PP ";v`Q4%.@QR (Ҡr`Q |   p:: ^IJI`i.ill.``l0m`y`mm``Pmmmm.``m@n0n U: jm``mnj{LM`o@`p@p@`oN```p `p0p@  p``f.ppo`m.0n@qq.``qq```qq``q0r``rr``Prr`5`r s``rps``@ssP``s0tts.``stpt 1?j0t``0tto!`Pu@`pww@uN```w vpv@  v|` ````f.PwPw q4v0tN @Py@wN```Py4 xx@  y  `` `|````f.yy8 v5/Ev0tpL y``y@z``zz```zz``z0{`@`{{`$`P{{`=`{ |``{p|```@||$&`v`|@/}|.``|`}`|`0}`+}}.``}~}.``}P~`V` ~~`m`p~~`0`~@.``!`.`````0`k`aP.``PЀ`k`@ .``< $j@``@gJ"``@` @N``` ^ r @@  &&&(`k`````7``n !``|`j "``|n``f b &`^ Z (`V '`R +``N `H `D ```f.``c ]v@ 0@N```0x l @h  ``f.pp{ V v@ p@N```p @    ``` ````f.A`@"@ @@0N```$  0@  ```f.'`@"@ @ .``) (j@``@so@ ``@`p@ @N```o J 4 @,  !`7`(`0 ``f.``M (Qv@ .```.`ЏP< `S` `-`p.```PQ Mj``Б9#L`0@`@@N```g X P@T  |n`````f.00z?`p ...`@Д@0lM!&`ʇ.kl[!@f.sa &`p.C!&`Z! f.:`\ `````00`*`l``Pf`/` p.``pp  .``p `0.``0p .``p p .``pc``@ ` `pt.``0`0.``0.``.``;P .` `  p.``p.`Y``P1 >jY``2`Z`0@`p `  0p@0@v04.6 @NZ```R F P@B   ``f.Ž%`.f.ppU ̢v@@@0NZ```l ^ 0@Z  ` ``f.,`.P .`Z`p@.`[`@p Sj[``P#풶HQ\`@`@P@N\```P x @t  0\` ``f.WX}`..`\``0.` `D /PЏ0&@PP`Ё0P-@P~`~~}@z y,yPyyx`xxwpw wp@   P  `p 0@0@P`p@@P`p 0@p P@P`p нP`PP@P`p`P}x0qpp@pooPoon`nnmpm mll0lkk@kjjPjjp 00@PP`p p 00м`P@0 `p ЗP@zyySS0SRHpH HG=`==<2P221'@'&&p   P``0@P`@@@@@@@@@@@@@@@@@@@@G `G L``G `0G A`4G M`PG d` G `pG <`@G `G ,``G `0G f` .G `@@ `@X!@ @ `G  IRN|`P@G @ @N`G `^ D  p@    `````T`X````f.``.` `T`X````Z! .`Z! .X`Z! .T`Z! .`Z! .`.G ``pP0l!pp`G PC g$` @G @@pN`G `_~ L p@@H    ```]`f`````f.00k`.``Z! ..G `0  Tj`G DOWmɊ`@G p@@PN`G `\ P @  ,````j?e````f`<`g````&`f.PP`0..*& :j`G pGk "u`@G pp@ N`G `\p @  P```f.`..*&@@PN`G `\&  P @  ```f.`.*&@P p`lM!&@ ʇ.`kl[!`f.sa& p.@C!&@`Z! f.:==.G `=P>@> @j>`G >>zN΋` ?@G @@@p?N`G ` @ p@@@@  @R` ``f.AA`>D`A@A.AA R+fj`A`G `A Bq8͞`B@G p@ D@BN`G `  D CC@  D```f.`D`D``AD.GDGDpGEF EpF`ElM!&GEEʇ.Ekl[!pGFf.0F0FsaPF&Gp.FC!&G`Z! Ff.0G0G:HG.G `G`APH H.G ` HAHpH.G `pHIHH.G `H`IPI )k3jI`G IIqSf<`0J@G @K@JN`G `K KPK@  KR` ``f. L LR `IOpLPL.LL )jpL`G pL0M|jfG`M@G p@0O@MN`G `0O*  NN@  O``f.pOpO0a:`pLO.RORORPQ0PQpPlM!&RQPʇ.Pkl[!RQf.@Q@Qsa`Q&Rp.QC!&R`Z! Rf.@R@R:'X`.P .G '` p.G (`p@.G )``@.G *`.g`*`G `Nv. :@f G ` G ``<G 9`00G N`P.G `P}8 _ 0 G ` G `P.G `  p@.G `@G `G ``0.G +`0 ŀj+`G @~&&`@ G gers@P@N`G `9P @   ``R```f.1<` ...p.... @`0lM!&Pʇ.0kl[!0f.sa&p.C!&`Z! Pf.:U8  i0iepe__ P__^`^^]p]]\p\XX@XWWPWW44@43,,P,,+`++*p* *))0)((!`!!@`p `0    P`p @@P`p@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@Kp?`pNp`@&Op`Bp``p-`P0.p`% O~jP`pP'ES`pp@p   @@f.PP@( 0O`0`?`1`h d `@`2`` `+`7`.`DA`f.` ` @g`@.  .p7`  ip` p P  .pB`   : Ajp B`pp 0 fފNk/Z@` @p@p @ N@`p.`p ` H  @>    `P `@`.`gB  @f.   c ~ jnp p   .p@` `0.p2`0 .pC``Pf hJjC`p+?`0@p@@N?`p.` x P@j   ``?`.`gn @f.``P KmGnP.p?` .p1` P`.pD`` ,(|BjD`pp=g8q9>`@p@@ N>`p.` @  P ``>`.`g @f. .nP .p>` p.p0`p P0.pE` yjPE`pPc|a;`p@p@P@N;`p.`|P @   `0`;`.`g  @f. -|fnPP.p;`@jpa`@G p``.p/` 0pp`@.pF`0  +PjF`p Le=t:`@p@ @PN:`p.`m X  P  @  G`H` :`.`f.  \`H/ @!!.p:`!!p.``!"!!.pI`!P"@"] ˅"j"I`p""G:8ާJ` #@p@$@p#NJ`p.`Y$ d p$@$@`  $$K`J`.`DL`f. % %F`".`%H/H/%% Lj`%M`p`% &Q6`&@p@ (@&N6`p.`Y ( ''@  (J`6`.`f.`(`(s``%H/H/@"((.pJ`(`%)(.pM`(%`)0).p6`0))pk`)*p `)P*p`` **p?`p**py`*@+p `++pV``++p`+0,pm`,,*Pp`P,,0p*`,@- -,.pN`,-- g+j@-N`p@-.@ܜaf9O``.@p@@0@.NO`p.` @0 //@  /  P`H`Q`R` S`T` O`.`f.00Pع`@-0H/H/11 )3Kj0U`p01]ӌK`1@p@3@02NK`p.` 3 033@  `3O`K`.`f.33{`0H/H/- 43.pO`30p4@4.pU`@4144.pK`40554.p1`4.P5 5  V`R@RMM IID`D??0;;67:6.6 7  p:8J7P:@083 :`98 8p:pT@@9 2p6`,93`4`5`6`7`   f.::28`H/H/7;p:2p6`7?P;.p; ;  ?<J7>@<3>> = P=?p@=, 2pH`,0>3`4`5`6`7` 4 8 f.P?P? !;`....7??2pH`7 D@. @ P@  C`AJ7C@A3pCBA BCp@BF 2p,`,B3`4`5`6`7` N R f.DD`@p7PDC2p,`7HD.D D  `HFJ7@H@ F3HPGpF F`Hpf@0G 2p:`,G3`4`5`6`7`  f.HH}`H/7H`H2p:`7`M@I.`I I  MJJ7L@J3LKK @KMp@K 2p4`, L3`4`5`6`7`  f.@M@MJ;ՙ`H/"7MM2p4`7RM.N 0N  Q@OJ7Q@`O3PQPO OQp@pP 2p7`,P3`4`5`6`7`  f.QQ]2`.70RQ2p7`7VR.R R  @VSJ7 V@T3U0UPT T@Vp@U& 2pK`,`U3`4`5`6`7` . 2 f.VV28`H/H/7V@V2pK`0WdpB`WWp=`PWWjcp>`W Xp `WpXp `@XXp`X0YYX.pV`XYpYL cnuj0YV`p0YY5,4ltH`PZ@p@[@ZNH`p.`[ T [p[@P  [H`.`f.0\0\a`0Y....pY\p\.pH`p\\!p`\`]@]].pG`]G ]DpT`p]=@]].pW`]"@@^^.pT`^ @^`^.pS``^/@^^.pP`^ @0__.pR`_@_P_.pQ`P__P-p`_@` `_.pY`_`` ij@`Y`p@`aCú4@Z``a@p`cc@aNZ`p.`c bb@  b-`.`f.@c@cc@`@`.@e@cNZ`p.`e dd@  d-`.`f.@e@eI>`@`.`epe.pZ`pefee.p[`e`fPf jf[`pffA\`0g@p@h@gN\`p.`h hPh@  h\`-`.`f.iiDN`f.Pf`i0i.p\`0ipii.p-`iG ,`p0jj.G -`jjP9 G W`PjjT<G `jJ kj.G `jpk2G `@k kk.G X`klG $`k`lG X`0llG f`lmG `lPmG ` mmG @`pmmG Y`m@nG Z`nnG 0``nnG 3`n0oG 6`ooG [`PooG \`o pG `oppG *`@ppG ]`pqG `pq`q0q.G ^`0q`xq@xq xqxrw rw@rw`rwrps sr6o! `x@x xaxwwww`x@x xxwwww^`G wqsMJ3`@t@G @v@tN`G _`kv u`u@  u`` `` ``6`a`b`c` ` f`X`d`X`e`f`g`h```i`j` Z``_`f.wwȿ_;`q. j`X`a`c```e`f`g`h`h`Z! .g`Z! .f`Z! .e`Z! .``Z! .a`Z! .X`Z! .j`Z! .xxx.G i`x0}x}yyyPy&!a0}aa}0}}i`G |x z .yd̶`z@G @p|@zN`G _`p| " {{@  |  ``6`k`3`j`Z``l`Y`m``_`f.||g~`x.`m`l`k`j`j`Z! .m`Z! .}}P}.G d`P}@} }~ ~@~`~@~ ! a@aa a@ d`G @}v @f2m`@G @@`Nm`G _`| `0@  `l``n`\`k`o`ov`hgp`gq``g ` X`c`h`[`f`e`g``.gm`_`>r`s`t`u`v`w`x`y`z`f.  >B`} l`n`k`o`X`c`e`f`g`h`h`Z! .g`Z! .f`Z! .e`Z! .X`Z! .n`Z! .`.G {``PЄP03`!PP{`G 0scj#u_\e` @G p@Ї@pNe`G _`dЇN > p@@6  g`: e`_`f.e`.g`g`Z! .p.G |`pQ fw=j|`G -#7RήSf`@G @@0Nf`G _`cp \ 0@T  `X f`_`D}`f.U0`.P0.G ~`s \/h`jP~`G P7lǾ%g`p@G @ @Ng`G _`b  ~ @v  ]`z g`_`f.`` k`P.Џ.G `  jЏ`G Џ03ʬ8<h`@G @@@Nh`G _`a  @@  ph`_`D}`f. dG`Џ.P0.G ` njP`G P/m`p@G @@N`G _``  @  ``~`|`{`o`hg*g``g ` `.g^``` ``_`f.`P.P".. `wH+jP`G P5RTp`p@G p@Np`G _``  @  `p`_`f.PP:-`P".. @КNp`G _``   Л@  `p`_`f.``Zi`P".@0@Np`G _``0&  @  `p`_`f.ppfb`P"О``PlM!&ʇ.kl[!`f.  sa@&p.C!&`Z! f.  :`@G @@N>`G F`<  @  0`````l ]`T`U````V`S`a` d   P L H  >`f.@@l٥`..G `pG `@G `G +``}NG ?`0)G k`: G `PiG ^` gG `p G 5`@]G 6`$&G v``0.G `0? uj`G @` A`@G    0@0@Qf.ppB o& v&@0@N`G `;0Q x P@F f.H ۍvf.PPL 1bvf.P <%v FFF6`^`Pd 00`0`0`````R`````P PL H S`P``X `r`s`Pm`vai<^ih`Vh```?`>Qs`ka8‡`f.5`@M` `@` `@a``p S`` P@V``p `]`` P@``p `` `@]``p `` P@``p `]`` P@U``p `]`` P@T``p `]`M` 0@`` `^ (W`M` ``P ``M` l M`@ p`` ``M`  P`p` `d (O`M`  P`` ``M` 0j PM`p `` ` ``P `` ` ``P `` ` ``P V`` ` ]``P P``gn  @` `@]``p P``gt  @ jG a`pL G `@.G `|hG ``l]G `0NG `_<G V`PlG .` G `p G `@. G `ΤiG `` G `0 *`OG 8`  z2G `P  2G `  fG /`  p @ .G `@    `j `G P B`  @G    @  @@ @rf.   c6dv @@ N`G `#rv  @  :::``f````````s,[[ #PmڨnTj `o`&n`ps`ve`s```Rkk [oD[``o`_`VQ8‡[jG`````````D`f.PP=Xh` .p.G 1`p. @@@wqqml@g gcb^^YXPT0T0OOJJPF0FBA==9p9P50510P+0+&&p"P"`@ 7@.`   TJ7@3 @TG  ~ 2G `, 3`4`5`6`7`   70T2G `7p.   @J7 @30P @G   2G `,`3`4`5`6`7`   *`f.`..*&f.00`P.*&7@2G `7". @  !PJ7!@p3`!  !G @   2G %`, 3`4`5`6`7`     f.!!]2`.7@"!2G %`7P&"." "  Z! #J70&@$3&@%`$ $Z! G v@ %\  2G `,p%3`4`5`6`7` d  h  7&Z! 2G `7*&.& '  *0(J7p*@P(3@*)( (*G z@`)z  2G )`,)3`4`5`6`7`    f.**]2`.7 +*2G )`70p+.+ +  0/,J7/@,3. .@- p-0/G  .  2<ˀ`,P.3`4`5`6`7`    0P/*00p/f.//Pa/".0 =]a0f.p0p0a0`Z! @p700/2<ˀ`7401.P1 1  T2J74@23433 03TG  3  2G `,43`4`5`6`7`    7 5T2G `709p5.5 5  D6J79@638 8@7 p7DG @8  2G !`,P83`4`5`6`7`     7`9D2G !`7p=9.9 :  D;J7P=@0;3 =`<; ;DG @@<<  2G `,<3`4`5`6`7` D  H  7=D2G `7A=.> @>  TP?J7A@p?3`A@? ?TG x  @p  2G `,@3`4`5`6`7` z  ~  7AT2G `7E0B.PB B  TCJ7E@C3EDD 0DTG  D  2G `,E3`4`5`6`7`    7 FT2G `7JpF.F F  0JGJ7J@G3I I@H pH0JG @I  2G `,PI3`4`5`6`7`    f.pJpJ]2`.7J0J2G `7NK.0K `K  Z! pLJ7N@L3NML MZ! G D@M^  2G *`,M3`4`5`6`7` f  j  7OZ! 2G *`7SPO.pO O  SPJ7R@P3RR Q PQSG @Q~  2G `,0R3`4`5`6`7`    *S0Sf.pSpSUYv`..f.SS]2`.7 TS2G `7XpT.T T  0XUJ7X@U3W W@V pV0XG @W  2G `,PW3`4`5`6`7`    f.pXpX"`.X.7X0X2G `7`^0Y.PY Y  \ZJ7\@Z3\[[ 0[\G Q@[  2G p`,\3`4`5`6`7`    *^]*]0]f.p]p]`"..f.]]QJ`".f.@^@^`"7^\2G p`7b^._ 0_  T@`J7b@``3Pba` `TG , pa$ 2G `,a3`4`5`6`7` . 2 7bT2G `7f c.@c pc  Z! dJ7f@d3fed eZ! G o@eF 2G `,f3`4`5`6`7` N R 7gZ! 2G `7l`g.g g  khJ7k@h3jj0i `i kG Y@ib 2G R`,@j3`4`5`6`7` j n *@l@k*k`kf.kk !;`....f.llf`...f.llUYv`..7l k2G R`7@q m.@m pm  pnJ7p@n3pon opG  o 2G o`,p3`4`5`6`7`   f. q q]2`.7pqp2G o`7vq.q r  u sJ7`u@@s30upts suG  Pt 2G ``,t3`4`5`6`7`   *0vuf.uu`v..*&f.pvpv`v.*&7vu2G ``PwG =` wwjcG >`pw ww.G `w&@xx.G `xxjG :``xxG `x0yy.G ]`yyx0G `PyydG B`yP zy.G a`yzpz@z.G `@zzz ];8jz`G zP{ #+A|``{@G @P}@|N`G `P}2 " }|@  0} ``f.}}}4 nP}z}G `}@~,/G `~~G ``~z~~.G `~0vG `G m`PG `` &OG `p\ G `@-.G `!G ``G s`0F G ` Ё.G `Ёp`7 ;Yj `G R$ʙi<`@@G @@N`G $`qv H `@:    i`H`(`k`]`> s``$`f.PP+~4` .z [0j`G `h 5H`@G @`@NH`G $`q`  @~  @`H`$`f.[&`.Ћ @`lM!&0Љʇ.kl[!f.ppsa&Ћp.C!&`Z! 0f.pp: @ B F H L N P R V X \ ^ ` b d h j n r 777                                                  $ ( * 4 8 < @ L N R T X Z \ ^  d f h l n r t v x                                               """, .  4 8 : < > @ B D F H J L N P T X Z \ ^ b f  l n  t v z ~                                                               $ & ( , 0 2 6 8 : > @ D H J N R \ 000t  z                        444                " $ 0 4 8 < > @ B D F H  N R T X f h j n p t v ~  ...                      --- &&&" . 2 4 8 : < J  P  V  \ d h j  p r v x | ~                                                 """ >>>4  < @  F N P T \ ` b d  j  r t  z ~        %%%                                              & ( 2 4 6 8 : < > @ D F J L P T X \ ^ ` b f h l n p r  x |              %%% &&&                                 " * , . <  L  R  X Z \ ^ b d f j l n p r t  z | ~            !!!                                       & ( , . 0 2 6 : < > J N P R T V X Z ^ ` d h j l n p r v x |          $$$        ###   %%%                (  0  8  :  <  >  @  B  D  F  J   P   V  Z  \  ^  `   h  j  l  n  p  r  t  v  x   ~             PPP                      f.//zd       f.0000Fd        f.`1`1Cd0)0! f.22ӧd0)0! vx22Pf.33Rd03& .p3d2`!  vL7R044Pf.p4p4 d4.4&>``! v\N35p5f.55{x7d5.06 b`Е! vx66pf.0707,d`7& .7Ύ C`!  vL7R`8@8pf.88Wd8.9^`! v\N399Бf.::䴡d :.`: 6`! f.p;p;?!Cd.;!`0;&  ! vx@< <pf.<<iid<& .<)E`0"! $! &! (! ,! 0! 2!  vL7R>>pf.??d0?.p?`8! :! v\N3`@@@Ћf.@@d@.AfQ`>! @! D! F! H! J!  P! T!  Z!  `! d! h! r!  x!  ~! ! ! ! <<<! !  ! ! ! ! !  ! ! ! ! """! ! ! ! ! ! " "  " " " " "  $" &" (" ,"  <" J" L" """^" `" l"  r" " " " " " " "  "  " # #  # # # # # &# *# ,# .# 2# 4# 8# @# D# F# R# V# Z# ^#  f# j# l#  r#  x# |# ~# # # # # # # # # ,,,# # # # # # # # # # # # # # # # # # # # # # # # # $ $ $  $ $ $ $ $ $ $  $ "$ &$ *$ ,$ 0$ 2$ 4$ 6$ 8$ :$ <$ >$ @$ D$ H$ J$ L$ N$ R$  X$ f$ h$ j$ l$ p$ r$ t$ x$ z$  $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $  $ $ $  $ $ $  $  %  %  %  % % %  $% &% *% .%  4%  :%  B% D% F%  L% N% P%  V% X% Z% \% ^%  f% h% j% l% n% v% x% z%  % % % % % % % % %  % % % % % % % % % % % % %  % % % % % % % &  &  & &  & & &  $& (& *&  0& 2& 4& 6& 8& :& <& @& B&  R& b& f& h& j& n& <<<& & & & & & & & &  &  & & & & & & & & & & & & & &  & '   ' """'  $' &' &&&:' >' $$$P' R' V' Z' ^' `' b' f' r' v' ' ' ' ' ' '  ' ' ' '  ' ' ' ' ' """' ' ' ' ' '  ' ' ' ' ( ( (   ( ( ( (  ( "( $( &( 4( 8( :( <( >( @(  F( H( J(  R( T( X( Z( ^( f( h( l( p( r(  x( |( (  ( (  ( (  ( ( ( ( ( ( (  ( ( ( ( ( ( ( ( ( ( ( (  ( ) ) )  )  ) ) ) ) )  ) ") &) () *) ,)  2) 6)  <) D) F) H) J) N) P) R) V) Z) \) `) j) l) n) r) t) x) ) ) ) )  ) ) ) ) ) ) ) * """,*  2* :* >* @* H*  N* P* T*  Z* \* ^* `*  f* r* v*  |* """* * * * """* * * * * * *  * * * * * * *  * * *  * * *  * * + + +  + + + + + +  + "+ &+ (+ *+ ,+ .+ 0+ 2+ 6+ 8+ :+ H+ R+ V+ X+ Z+ \+ h+  n+ |+  + + + + + ++++  + + + + + + + + + ...+ $$$+  + + + + + + , , , , ,  , $, &, (, *, ., 0, 4, 8, <, >, @, D, F, H, J, L, P, R, T, X, Z, f, h, j, l, n, r, t, v,  |, ~, , , , , , , , , , ,  , , , ,  , , , , , , , , , , , , , , , , , , , , 000- - -  $- &- *-  0- 2- 6- 8- :- <- @- D- H- J- L- N- P- R- V- Z- ^- b- +++x- z- |- ~- - - - - - - - - - - - - - - - - -  - ///- - -  - - - - - - - -  - . . .  . . . . . . .  . $. &. .. 0. 4. 6. 8. <. >. @. B. F. J. N. P. R. V. X. `. h. j. .... $$$.  . .  . .  . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  . / / /  / / /  / /  "/ $/ &/ (/  ./  4/ 8/ :/ >/ F/ H/ J/ R/ \/ h/ v/  |/ ~/ / /  / / / / / / /  / / / / / / / / / / / / / / / / / / / / / /  / / 0 0 0 0  0  0 0 0 0 <<<20 40 80 :0  @0  F0 H0 J0 L0 N0 P0 R0 T0 V0 X0 Z0 ^0 `0 d0 h0  n0 p0 ~0 0 0 0 0 0 0 0 0 0 0  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1  1  1 1 1 1 1 1 1  1 $1 01 21 41 81 @1 D1 F1 J1 V1 Z1  `1  f1 h1 j1 n1 p1 t1 v1 x1 z1 |1 0~1 v/f.@@1 v/_Е1 v/f.001 @nv/^1 v/f.  1 v/\1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1  1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1  1  1 1 2 2  2 2 2 2 2 2 "2 $2 &2 (2 ,2 .2 22 62 :2 <2 >2 B2 F2 J2  P2 R2 T2 V2 X2 \2 `2 b2 j2 r2 t2 |2 ~2 2 2 2 2 2 2 2 2 2 ///2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 +++3 3 3 3 3 3  $3 &3 (3 *3 .3 23 63 83 :3 <3 >3 @3 B3 D3 H3 L3 P3 R3 T3 V3 X3 Z3 \3 ^3 b3 d3 f3 h3  n3 p3 t3 x3 |3 ~3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3 0003 3 3 3 3 3 3  3 3 3 3 3 3 3 3 3 3 3 3  4 4 4 4  4 4 4 4 4 4 4 4  4 "4 $4 (4 ,4 .4 24  84 ***N4 R4 V4 X4 f4 n4 r4 v4 x4 |4 ~4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4  4 4444 5  5  5 5 5 5 5 5 5 5 5 5  5 "5 $5 &5 (5 *5 ,5 .5 05 45 65 :5 <5 @5 D5 H5 L5 N5 P5 T5  Z5 vD!P%0%Z! .f.%%/rd!.m\5 v~dP&f.&&_5 zdvv&Йd. ''c5 ,-erP  Ph5 vl!''}f. ( (V1d!Bt l5 n5 v1)f.@)@)`!`610 0 d1p5 f.))U`*]$]0*.p*\cIa ]t5 v5 999v2@+f.++(m`2 .5 f. , ,}`l |5 v-@-,4,` 5 @f.--]$[d N.``k`p/,5 5 .p.@5  .1``.`k`Vjj?"`4?y @??` #`*`+`,`-`f.//]$[d 5 5 v~d0f.005 f=v&5 6 999v21f.11L`2. 6 v 222t!t!2f. 3 3a! !.m.m$6 v 243f.@4@4쥈d!&6 vl! 550 .f.`5`5Ld! *6 444v26f.P6P6Ad2 a D6 v17f.@7@7=o`61fp7fF6 vl!088D1D1P8f.88 s7a!Z1J6 vD!`9@9Z! .f.99WQd! .mL6  vب^:`:f.::Q6 ivR  &V6 v@A;f.;;X6 ˺>cvC#&\6 v 2<`<t!t!<f.<<oXa!!.m.m`6 v1=f.==8S`61d1b6 v1>f.>>Ѻ%`610 ?.d6 vD!??Z! .f.@@nbd! .mf6 j6 vBA@4@`An6 @ AQf.AA_X d N`p`mpC@6 6 CB@6  0C```Q`f.CC_X d 6 vE0EPD4D0 D6 @ D Q E f.pEpELPd  QN`p`[pG GF6 6 FpF@6  F``0  6  iD@@@@@f.GG` @ @ 6 @6 f.HHYK`H\$`\H.0I0GEa[6 vfeI4I@6 @*8 vNNJ4pJ08 @P8 vZ`Y LK4`K[T8 @`Ԅ9z8 vd?yLLf. M M0 /d@M.MiL`P]|8 999v2 Nf.`N`N`xE`2 f8  v0O4N8 @9 v>APf.@P@P9 vD &:^9 v1Pf.0Q0QA`610 d19 v0PRQ4Q.9 @ RQr\< vD!@S S!!`Sf.SSGoa! f !`< v0UT`T4Tp d<   @f.UU,Nd N```VT< < 0VV@<  `V`` Cp f.VVR` < v`pW4 W< @< vd?yX`XЕf.XXg; dX. Yg` `< v ` Y4pY@< @@ "@ 999v2Zf. [ [a`2f@@ v 2[[` ^ f.0\0\I5d! a B@ vl!]\D1D10]f.p]p],+a! Z1F@ v|| ^4]YJ@ @C v 20__0 t!t!P_f.__SXa! !.m.mC v1P`f.``\C`61`.C vd?ya`af.aaxda. bP`^C v`bf.ccC fi_v#&C v1cf.cc`61d.C v 2dd}f.ee&0d!Bt C vf@fe4ep$ C   @f.ffd % N}` `he\D ,D gpg@(D  g`}`p$ f.@h@hj` % `D 999v2hf. i iSa`2 .~D vEji4i0 @jD @ pj j f.jj0Ld  D 999v2kf.kkH`2 fD vl!ll0 D1D1lf.mmLa! Z1D vl!mm` ^ f. n nd! a D vo@on4nD   @f.oo>Jd0N` `qnE D ppp@D  p`` Cf.@q@q\a$`0E vl!rqf.@r@rpd! E '''v @ r4r"E @NI vl!ts.f.@t@t,+d! RI vx%tf.0u0u }dU% TI vP3uf. v v?u2d0;3VI v`v4pvZI @lI v4ywwff.xxܜd0x.px&ff`nI v 20yyp8f.pypyt_d!;Bt pI  vL7RPz0z f.zz dz.z` vI v 2{{и f.{{e]d! xI I vb(}|Тf.@}@} td(II v1}f. ~ ~/W`61d1I 444v2~f.d2 I vD!0 !!f.@@VKa! f !I vl! и f.``{d! I v4@I @:L vx%f.@@QdU%O vl!Ў.f. s7d!BO  v ^f.GO #vDE &@f.@@LO Umvv`v<6Зf.PO [ MvvwS@f.@@TO Bwfvv֫3`(I@f.XO vvhTvf0`JnP&0f.pp\O vvDMv|v0?v0?0vdJvdJ0vf $$$".DPh0:$Pp0P7c@'4yq,(@"8f'4-Ʋ-@ e ,<t'@0y$g!g g@ff~4j4@;T[@847@4--f@ ^|_XgCP>2P,TF0P>$!~FF aP#g !&,T%P4&gP0PbU%hEDEPONpbpP`PPx`5@P PP@{п@lо``zY4 F|y `8? _R6` X ,`> ~yp`ڸ(  & az`@t@8^ww@ [y f@>x)\8s@c*515F@hF7\&,z%,@,[3p68`0c C[p`@p gЦ^2XgC2*Pp0܆@^2XgC2h9`@@@ &@М^2XgC2Pk.P@P R5`^2XgC2`1 8<<8`` Ra\:6P wvД![~SPkaF,Г^%8'PX"0;ВS?P "Б=^2XgC2P wЏ"gP 5P9Ў?P>TLЍ`PЌJ8Q0P9Ћ|`rC`0xЈ@8o'01@^2XgC2Zz.Ђ0P`p`0p0P?~P~^2XgC2Mp~^2XgC2n\S0~,zU}\}p}P"0}{yyy @y4y>xt,x^2XgC2@xx@ww@vv`duMuz-@u5.u6't[1tT7@t(ctƴ7s7s7@s!gs?rh\>rl7@r%gr\>q1qpM@q.SFq.pn1p1@p%prl%o1o1@o{o>~wnņnw@nڸwnʛ{mPmm$V+@mhJm(l(l^V]@lpsltk`4```k x@kkڎjĜjFJ@j|4jVfi 4i|2z@i,;5iG7hl7hb!g@h.#7h V5g'5g`'5@gE/g8fff:`@f8fh#ei.e##@er0e,d,dbp0@do0d~_czc|@czc"bUb$$@bb&b%aHUa&@ak.aj.`D/`##@`"8`f_,"_3@_\2_u[^X>H^x'@^p'^&]6)])@]!]1+\0+\?@\\&[z[!@[![4\ZU<ZP@Z'Z(YFYF@Y$7,YJDXdDX0@XX((WD{!W0@W'W@&V&V7@V&V&USU.M@U&URT T6 @T1TMS&S.@S(Y5SX5RX5R41@R1Ry%Q"k%QL1@QX1Q&Pb(P7@Pԑ0PJ&+Or0Oғ0@Oس7O HNfcN$@@N&N&M?M(0@M#Mb0L"U<L2P@L)L0+KP'K0@Ky!K&J|&J7@J&J|)I"N.Ij5@Ih5Ih5H*H*@HMH.FGFGI-@G\:`G1FX}%Fl%@FB1F1EI-EI-@E(EZ)D*D4*@DMDҿ1C1Cy!@C`y!Cv0BHBR7@B-B-AB,A",@A@MAT`@`4``^`@7@@7@Jg?LZ>?Dg@?.[>?P> > @>z >Z =t=`4```@=)=*<M<vb5@<1<q%;l%;1@;^5;^5:X *:+@:%:09D9RP@9(96'8fS8>9`@8#+8#+7@7(@7i!7n!6M6F)@6 t!605f05.6Q@515M44'4',@4',4`',3ν13x%@3j%312P20@2D2rP1r-1t1+@12fS1b9`0.0$1+@0,0,/X,/8,@/zV/ԩn.`4```.l*@.x-.i!-n!-t!@-y!-y!,M,f1@,L-,P1+j?+(U@+ 7+,L.*rD*z @*pFJ* ) )7@)~g)zZ>(*(*@(LM(:1'1'1@'''?&jn'&f@&X'&f%,%ƶ4@%`% ,$,$2T4@$~U$(6# #Աy@#~y#K"R"Nf@"X "!!S+@!dR!/>  C 6 @ F08 n)-J\J@~(-V(-6(-pC@|>>6Jޒ@`4```>:6@3ay20f@~f23UghTU@<"th<<@C6M,"@ZyR|_(@_(`4```&6@3aV.""/"0"@"%np'P ?Dz`̗L Ffb`. 2tF3,`  "y ` 5 QQaXax H Q ` %8 b1c\b1c 1c b0c\bH1c` 5 JQ n *` b8 @J  ~{  J` 0l  ?xE`RE b[I$PP`Q 0.J.`,F% NP1F77`Z7 <%&,&`Q **,*`r? **PM`F F,9``1 Ȃ%k%1`t1 ,`,*`* rMж,ξ1`J% k%1,`v, ,{XNB[I`LX' W'J\?`>f '`7D`b? '27Q`r=5 '6`#. <JBz`}H }H-zT7sp79`' Q5ȹcg`0" EEl!`{ bJ 8?`b*8 dJfP<]`Gl Fgf4`S S@JE`E ?[@`  ':' j7gLӆ`иg 55QLaXa+?`z? ކ?~C[HO`O DlDO.̰y`}5 `SF:c:c`' ?P['Z'`mU W12p2`B% @*MI`S1 RS1U1zU1`fW1 P1T1)`* ) D%`<T%T%`& &&%&&%&Z8sTj`o T|k'k'`T7sp7:7 ,33`H^- \H,V4U`N' (nS].`$! H_$_`l_+ U`c R, 0>K`hR # n `za T7~9p79_{r"`  $Z$`p % k*7#`~- (t""`8* $O*pk*`D @\?{`rg5 gnf>>`;5 Q5Pg5f`" &"4h {` Y8 j&>1M`6 61v1*??`6_ j_*l!V+`X 8t``4``$` DH}5`P_ f,6''`E E(eS`ΰ  ._ `  D!>=4>>`r> &p&D&`& &&&w!`>7 'bt!`t! 4's!>x!`x! Mw!w!`* l*MBN-`1 |%Rk%1`N- M-61'`Bt! '0) )`v* *Mf11`λ) *@*M`1 1E. &`F3' Z1`&B0`D :P (ā'`& &7D&`) ^K.Zf5e5`e5 r-R)9``5' "/+H*`P ( i!m!Dy`RDy >=4>>#*&`jA p% w!\*`f+ ^*0*Y>(2,`2, 1,1,2,`u `4```*FJ`6  7$P1`y &_n`BN, w!~7# ` H |S`H R.& `` @ μ&RF`@y!  y!01`8Q ,41>2'`* B.DD>*`H LFJ !A`  `4``v``XH &y!x!`& x!x!x1`zw! MZw!:w!`* *Mf1`1 11Ԍ1`L B56޶ `f, f,f,~f,`^f, bu`4``(` E[`, (.E E`   * ` D!>=4>>` &J&'`t! t!'*`J& >=4>l>#l&`(jA ~x!^x!`! 070`, :,,,`,  t`4``b`x.`*m ""]'`^' Xb6gRD'`c x|?{3`2 |Q4{Ub3`l2 NQ4~`{U~3`~2 ~Q4}{U}n:?`}J7? }ԊJ|d`|}{`|3 |2{^R4{||U`{^3 {B2zR4z|U`zrz zaEywyb1c\bb0c\bJ\`y<52 yFnx?xE`x`t x82w<>w^>`wb) wtvfQv4k`v0w vT)u2*uV)`uX) uW)tnjttPt8t(os(oQ> sb:c\b:cPs|:csb9c\b9cr*rVPrZgr'qcJqmaPqH9?q:?paEpb:c\bb9c\bwPptwpjyoo|5PoofnfntPnknnmTm0Pmʚ m"[l lp8Pl8l>YSk PdOd,nc>Sc2nPcrc !b !`b"Q b$QaQa`a}j aQ`V}j`Q``Q `Q_}j_kk`_ _(oQBt^\)^J\)`^>]) ^4@]@]z|P]@]T\\-\-P\`-\ -[%,[.z>P[_[n"Z"Z5+PZ4"Z&Y?V8&>UJU-PUڳ"UJT.4.T"PTn~0TF*S$SrF*PS p*SDzR}HRn}HPR<2zRH>>QF{QXlPQQT*PGlP3PP2P0R4OL|UOZPPO?O#Nh'NT7ڨnp7V9PN,G/NG/MLG/M&nPMT7sp7Y@Mp?L֘nL-PLQL""K""KV'PK "K4#"J#"JDi'PJT7sp79Jb'IQIڷ`PI|5In{5HxHrfPHSHjGʗ@GZ@PGsGF0-F-PFU)F4W)EnE6PE4E-D-DfV)PD\SDDGlCUsCnnPClC82B^P4BPB !BYSAm|m> An\S%?PA69cA3@2@t[P@h@O4?fuU?:}P?j`S?mc>8`>|EP>XE>Z =F =! P=d =X<H<C!P<>=4>:><%;(;>=4>!P;j ;%:z! :G.P:v!:B79v!9p&P9v!9xv!818R4P8v8t>7_73P7.27"Q462{U64tP68c6^<5l<5ܳ8P5n9594zh4vcaP4jO4T7sp7?3f3A.P3L.3@22T7sp7&$.P2SF2?1j|1f*?P1QsXaF*?12-0D80P04.0f8/'/PsPd3P/>C2/'.>.>P. >.*?-P--\P-P- -Ұ3,RqT,P,Z,s+8c+QP+,8+ *V>*kP*m*h)m )!P)Q")bf(!(B@P(@(FxU'!'7P'G'*E&E&EP&E&wU%* H% HP%\f%E$ZE$8P$8$E#\wU# HP# H#pE"E"H8P"v8"G!U!wUP!vU!H H 7P 8 G.wU:HPH777P!!D!ܭ!P@!r8EPEH:fb7P4vUH678P!z/yP4PFF>`)yP}>`z[PT*PZ:Pzڕ zPC$>0PLY"pS~pSF =P 5PV_&CPfCP<P7P>!KL P6T7ڭp793+&8Pf(?ԣ8#P|{  DP D D hn 3+P X=  H { L}P ". d ?Q b4P |z } z aPP 3 F2P4zUP32P4{UP~jD32P4PyUn3 3PtX4Ut*3P3X4U _)P^)^)2O.mP--`-*?Pn\S*?32u[PO4uU?*fP`*VsUsn[S-|h77P0gnY>7P^gY> P8tP^'P33Z4UP|H+lZ4?Pn\S?3 20o[P|34EU,b6PĆ&w#.#P&pFlDOz2zPj|z322P4PyUx>NTPE6ERN_P.}UvN0{X^P|5j<0c 0cPV|5x|5ORNURPOr12Q@QQQ@TQQQ@Q8V)lQ@r (oQ v@Q8Q4|5V)@U)R$Q@QQ@ !@O$RRJ/c@Q t.O5@NA5L5f1F.@`>>z;@ &x~&|/?@&)y763@@P2 z-k5P @tJ p` P `>-> w'POSP3`D2 f3U7D.?`J;c |f_rN`XW !O(?,`08 :?<,?`n\S,? HT4~U`x}  vu8``E! "+*T`  G7,Rl7`g *-*?>G7`- ~l7gNf`f ^_l}*}*`f :/O,_`¥, ,,>Q``4``` n\S.?§63`3 bv[:jU4`&U <`S[7&l7`g m,B-f-`԰4 l686$f`.N ^OZL`L`^_ b/c`]-JH` tNuNvNFwN`y fN[`r- Đ(i-7]`zi- Rg8]Jf`0- -`ZMM`tM MSo8`Z  -x-z -`#. LG7tk7g`|H |H-zZ`| Uyp-`' 'M,(%,`~>  _,{{`Ԭ{ { {~{`x ´4S7`' *++4`|x> +_Zj>`R_ 7j7g`bX> y`D ---`k" $d$#%`~f DX֘R`\KM r.n.*`7 6?\JRA.`H2c H3cdz`Ly l4&Sr.`\ 4v`HV`H`" \ < 9`T7~9p79 6]"P$.$`L%  8<%>.,`b" ~J6#.B"`f" &?*$G*`o*  Bz{H{H`z ~;>| $`;/ H/  7fL`zL L 4 S`"S   6`=1 7+,`< /c}&_5`) H4fSZ.`. v.X`2'`4, 8"` ڔ ~49~T7~9p7 9`~Be" ~n"}$} %`} 8 } %>|,|L"`|6J |".{,"{"`{:* {$z9*zPo*`zAz z{HyzHy,z`yL;> y *x~*xM`x`1 xp%wj%w1`wy wyvhVv}&`v6 v6uv6uV6`u`4``T` u( tSFt^q!`t7 t&+s.7s:.`s s rPUrG`rf'A r q4q H`q qz@ p+pS`p+ pl+oh)oS`o o ndUnG`n'A n m4m `mb m+lfl-`lL l΍*k<?kn\S?`k2c kԏ3j22jq[`j j;4inPUi<|`i`S icSh.`hD)`hcS hL.g1gM`gbP. gƷ1fo%fe%`f|1 feX~*e2c`ef e_d QdH`dL d2ccHc*`cB cbb3c`b8 bPEaYa`a[ a3c`D-O`Hp,``E `_fp._7`_7 _^ ^X `^. ^&]1]M`]M. ]1\1\%`\e% \1[(1[M`[ʼ1 [1Z*%Z `Zs" Z$Y$Y,z`Y, YX"XZJ`X#. X"W:"W9*`WƢ$ W~9*V|o*VAz`Vz{H VZ{HU -zU`UT7ڭp7b9 UX &T6 &T &`T & T &S`4``J`SE/`S8 SfRT8R87`Rr# Rʂ&Q`##Qjr0`Q(p, Qp,Po,Pc`Pn0 Pn-O`3cO<3c`O~ ONN^*`N܃E NEMM'`MP[ M@L^KL6`L]U LfUK8UK,`K8 K@JB[J7f`J|7f JO IJ?I{?`I_ IVO H>H `H H|?GxIG`Gz? Gy?F,F|z`F:Z FEE)8`E@J E`?D@?DBz`D D(8CxCd$6`CQTXa> CPaRB8PB8`Bj6 BO.A-A7`A' A'@PsP3@L3`@U4 @TU?P?h `?>, ?N.>P>.`><. >0J.=1=H `=b{ =Q.<,<f`<f <n\Sx>;A;c`;l3 ;2:Lf[:`:  :49 U9'`9' 9C[8y85`85 8B[17h_7_`7TI 7E6tE6E`6@E 6,BJ55x `5`' 5WI4P.4'`4* 430k'3T7sp7fi'`3x{? 35252x5`2Q8OXa? 2c1 @..@h1`1* 160('0 `0 @..@3 02/94/NU`/X3 /P2.94.NU`."3 .2-v94-NU`-O - ,,`, ,.FC++`+` +z*y*E`*E *@)h: )9 `)(E )E(8(8`(f (jE'HE'Y`'8 'l_&&H`&8 &9 %@e%9 `%]U %H$d$9 `$l9 $r]U#fV_#]U7ؕ8`8 ڷrEE`6E Ҩdf`:% 0(s*2 ` 5 FCah8]C`y v<h`x Ґ[0*PHDP` :44z`y JE(E4`8 EjELd`8 7f84`4 r4pF8f`PF8 0F8 F8dh`sh Dh$hb]C`&, XIbXIZE`6E ~Q5HE8ja`RW8 P8z8c.`4 ȩH , $5` a5   H` x N8 Q" "` $ 0 % y `H` `H " ,  ` 9 T7~9p79(f"6k*`Ȭ7 H,v,4"`J #.""`:O* f$P*k*`>Cz :}H}H"/z`"*8 &>~=>>=4>S8`WA ,t39`8 8T37`3 &34f΄,`U K8fS8``a bP8BP8+` _'`Z` ^_#!`& >gR&\Y8`) )(_`t( `4``x`b&&``4```  ;1Bc&`B* BAQ*M`E EܔH8``޹1 %g%1`1 {4H>`2+ `z>``hi> P`&`. N`T-  M-D.`. <"N<`dT- &oML`F8f `Pai0H`" "c6PQ5`. |.H.*5`& Ti5t&` .w#ʅ#x`y Q6w#`#`rx .yOz$` % $!%|8f` y L&T7sp7r } }`hg @ƿ?BaPf<[?,@'PsPK5?E@ҟEbCDA~K@ OU.9U,6@<rjRj2j@j:yEtE@i$8دEE@8f8i@94iiri@Ri,ba>=4>,@FR8XA>4UK@jf&R8(aaT8@,FS?n\S?@ 32r[=4@VUP0P[PT7sp7T7sp72?f>r_P 9p &r_j#Ph#xOzPP"8(eT7sp7hP<ҙ<<ZP<?f<\`P{oz64Pu>| ,7[$4PSe',b' b'PT7ڨnp79 G/"8(8PZxN]`4{P؏5|(Яyt5P\(<(TCRP`0ȫ!C#P,>@,XX`P##DxyP̝CeP5QPHvi8niPT7sp7 944"h<P\780'P5"i'пn"X"PZ$,%о|f/'P1Mн1p%P h%1мviHfPT7sp7'лxJP99к<zPl-{X{йt5rzPz$и% $ (o$ @z z  N{ @:-{ >z nk 8 @8 J J Щ' @ڌ< 4e } D! @HU% o% l! M @1 j ' 4e ,% @(o$ "0 " i' @5" ~1' ڣ ,8 @7 &l 6>" v4 @p7 Q T } @Q YI rYI 4e @C x Tx # @z# |X` :n+ > @`* # D   @YI &R C Zn @ w5 HKy 8 @<6 X{ ]` x @bZ $8  8 VF/ @p7 U' h' c' @S <4 7[ :n+ @> <4 6 ,hz @X{ ]` <  4e @4K  :n+ D+ @<4v<4f.`O vvwS 0hT p֫3  :2 03 p\S  S 0D, pT8 N_a S8 04e pK hT ^VA 0^VA p^VA ca , 0 i pF< r  `dC 0֫3 pfF 8 4e 0l8 p2G 1 @A 0L p2G 1 y 0rK pK 2?I \>I 0 p6 , hT 0hT p^h ? ^ 02G p1 ]h ]h 0P px, [[ [ @4e Ba (?@? @ P(?  }  } & Px 4e $ (o$ P$ (o$ Gz x PTx x# Z# x Px Tx x# Z# Px >A i5 X6 PX6 +5 G% G% PG% lO] Zn " P" bH s^ P P4e DM DM ή& PT- nk  &l P. >.  Y< P@A? n ήN  PZ<% |& <  _ P>  _ >  _ P:n+ > <4 { P1 D! HU% ց% Pl! .` nH 2G P1 M {1 AQ Pw1 h' c H;1 P` & 2' ` P( nH nH {1 Pw1 `> ή& gR P"> = DM  PZ` (H ̰' _ P4H + V8 U8 PN_a S8 4e K PhT D, 4e :2 P3 4K d 8 P8 R9 Z ^VA P^VA ^VA  F P| z bH H PD7z ]* [* d$ PTZ* " (" @bH PvJ aH , `> P~7 D\* "  p7 P HS ~E S  RtK P 0|S L x  $ P (o$ "0 rG"  08 P Tx  %5  S] P Nb5 n%5  ,  P G% za W8 PW8 [ E8 D5 P2G 1 |8 XI P, TTC GC FC Pch DC O8 F8 PF< 4e r  `dC P֫3 fF 8 4e Pl8 ld 2G 1 P@A L 2G 1 Py z rK K P 1P W J[ P2?I \>I CC  PHKy TTC : DC PX μ Hs* R0 P8;% K 4e ld PD E <E r  P8 \ \ hT PK K >z  C P 4e 7 D !dL P!C !L !K "TY~ P"TY~ "-e "-e #4e P# #4e #P_ $hT P$H% $MI $ld %  P%hT %ܾM %De &ҼM P&8 & & 'VJ. P><. >Y< >pP ?N. P?LM ?LP ?  @hT P@֫3 @:2 @3 AP PAI A A BO. PB6 Bg BpP CN PCXa C<6 C\ D)8 PDZ DD7z D" R|& PR"# R Rڡ8 S4e PS®8 SE/ S` TV] PTM TVq. Tq. UnH PUp7 UHS Uz VbH PVH VD7z VD\* W[* PWd$ WTZ* W" X(" PX@bH XvJ XaH YS PY, Yz Y(o$ Z"0 PZ" Z~E Z$ [D! P[l! [M [1 \D! P\HU% \.% \1 ]l! P]M. ]M ]1 ^ή& P^Y< ^i ^ _uK P_ _ _0? ` P``C `|p, `Z$O auV Pa[ a aZ bpE PbĶ bb bd-O c8 Pc c* cH dc PdL dxH d Q e_ Pe4e eH e҃* fn PfD! fHU% fo% gl! PgP. gM g1 hY< Ph\F! ht) h.` i4aS Pi_S i^v ihT j֫3 Pj@;H j j:2 k3 Pkpb k\S k l* PlDM l- l4e m PmC mQ m4 nQ Pnf n  nhT oVQ Pol5 oS ot) pD+ Pp:n+ pS p qC PqQ q H q4 rQ Prf r  rhT sVQ Psl5 sG% sEH t)+ Pt tq! tQF u Pu` uV] uV vV PvXV v|& v`, wx Pwx wD! wHU% xo% Pxl! xM x{1 yw1 Py yz ybH zH PzD7z zD\* z[* {d$ P{TZ* {" {(" |@bH P|vJ |aH |, }F P}| }$ }(o$ ~"0 P~" ~p7 ~HS ~E PS RtK 0|S L P5, 2' Ѐ G% PG% G% ЁS <4 P) ~_5 Ђ}& Z'O P $, ЃM  P<1 &6 Є  PS S Ѕ<4 DM PL L І4e  PL>/ .4 Ї f И7 \7 P _ > Й _ :n+ P> <4 К`* `* Pj ' EH ЛS <4 Px J{ МJ{ J{ PJ{ J{ НJ{ _ P> , ОM, * ' P* ' M П0? HKy P| :Z Рz bH PH f СH7 %7 P@bH  - Тz - PZ K УS DM PDM DM ФDM &- Pp- 4e Х8] pQg Pi- Z8] Цi- ~( P- 8[ Ч4e n PHKy FwN ШuN sN P H Щ*h- M PZ__ DM ЪL O P0M 4e Ы6 6 P<4 {- Ь- r, Pf H7 ЭU7 _S PhT ֫3 Ю@;H  P:2 3 Яp_S \S P` V] аV Z, PP M бM \/O P4e N* в(* Z__ P4e 4e гf H7 P, %7 д R Pf H7 е, %7 P R жtU] C! PnH 4aS з_S hT P֫3 @;H и :2 P3 p_S й\S  P  к0? 0? P"O R T л* * P\F! .` м4aS _S P^v hT н֫3 @;H P :2 о3 pb P\S  пJ 0? P| , ? `"O PH g- DM 4e P6z PnC ( ( S P$ (o$ "0 rG" PG% (  8( x PTx ^S5 # z# P4e $j4 4e d4 PP@  # FI D P C Zn P PI  " ЂI PI 6 H * P"]h `* `* `* P ήN  [ PTh / / .' P' R T R T b( P& 4e v F| PhR ~ 9 9 P9 ~c hT ֫3 P:2 3 hT ֫3 P:2 3 P w P ff.d e0& @H7 U7 P7 dJ0f.pp-Id00 dJ)0f.@@vd)0)0 F J 0?f.ppPA$d00 0?f.  d)0)0 0? 0? |f.PP˪d n8 v`0 0x pDMvDMf.dO #DvJnЕ&` pL7R x DMvDMPf.hO -t*vJn& L7R 0x p.? |& Tx 0l|& px x DMvDMPf.lO \vJn& "z 0L7R pF. 1 D5 0D5 pD5 Y<  0v ppb R vj 0pO pQ Q Q 0*~j p*~j Q *~j 0Q p*~j Q *~j 0Q p  " 0||j p|Q |Q |Q 0f pf   0 pt t Q 0Q pQ Q unx6v @JO uj uj uj @ZR \b \b  @Q tW^ Z{ jN @hT _ N 2G @1 S `N 6w @hT ֫3 :2 3 @^v z Gz J5 @@A x# Z# x @>A X6 Zn hT @֫3  :2 3 @\S  ֫3 H @tH hT ֫3 :2 @3 P I C> @f 7 C> f @C> f 7 7 @.` S- S- ' @`C. EH EH -| @[S 4e ? hT @֫3  :2 3 @\S  :- d @O d O _) @r? a? hT ֫3 @:2 3 {) hT @֫3 :2 3 {) @hT ֫3 :2 3 @{) hT ֫3 :2 @3 hT ֫3 :2 @ 3 fbP  z $} @ >z ^VA ?Q 3Q @ B. L} { nH @ = :5+ [ D @ D ШD  >{ @| # ڡ8  @4e ®8  7 p7 @HS ~E J @! @S  `C D @4e 7 D dL @P_ X 5 ~pS @= 0 V> C @\ z \ t\ @z ʆ\ = = @W š[ =  _ @> x  _ > @b ֫3 x z @! @    @hT  f   @JE JE @ ! @L @ ! ! @! @   @    hT G @     !  @!hT !hT !hT "G @" " "2G #1 @#  #  #hT $LE @$ $ $2G %1 @%f %  %  &hT @&JE &2G &1 'JE @'G '@ '! (hT @(@ (L (@ )4e @)rG" )R ).U *g @*2h *vj **W> + @+/8 +v +pb ,R @,$ ,< ,hT -֫3 @-6 -S- - Q- .\> @.> .> .> /v' @/:2 /3 /P 08 @04. 08 08 1VS @1Xa 1< 1j| 2[ @2SF 2Y< 2ڌ< 3@ @3,M. 3A. 34e 44K @4Њ< 4ca 4:zh 58 @58 5,8 5< 6D @6\b 6pO 6hT 7֫3 @7:2 73 7_ 8> @8b 8֫3 81 9o! @9No! 9ή& 9rA : @:# :I. :bS ;V?H @; ;V?H ;Zj <V?H @<4> <\F! <{P ={P @= =aS = > @>2G >1 >.` ?4aS @?_S ?^v ?hT @֫3 @@@;H @ @:2 A3 @Apb A\S A0? BYS @BQ Bb B֫3 C @CQ CQ C*~j D*~j @DS DU) D{- E- @E<4 EQ E*~j FXW) @FU) F{- F- GQ @G*~j G+@ Gc@ Hq^ @HS H4e Hx I @IQ IVQ InQ J' @Jp7 JU' JN" KT#" @K " KV' Kd L|d @LQ L*~j LA MD[ @M Me M|G/ NG/ @NVF/ Np7 NU' O"> @OP? OP OhT P֫3 @P:2 P3 P{) Q* @Q QQ Q{ R @Rz RbH RH SD7z @SD\* S[* Sd$ TTZ* @T" T(" T@bH UvJ @UaH U, UdJ VF @V0? V| VRtK W0|S @WTx WU5 W^VA XU5 @XL# Xp7 XHS Y~E @YS Y>G# YL Z@A @Z6>" ZA Z"0 [" @[_ [> [, \- @\d \O \m ]  @]@ ]| ]t@@ ^t@ P^^) ^\) ^]) _ P_" _||j _|Q `|Q P`|Q `f `f a Pa a at bQ PbQ bQX ! bQX ! 0cunx6v cS cS di @dJO d@) d e' @e eI euj fuj @fuj fZR fvC] gh @g g gn= ha) @h h hL) iL) @iL) iL) i 8 jm @jm j2G j2G k1 @k1 kV.5 kG lP> @l\ lK l mX[ @m ZH m \ mdT npb @n\b n\b n4e o4e @o oQ o pHKy @pw pw pBIE q9? @q7? qla qtbJ r @rWg rPH r&* s\b @s\b s\b sQ tQ @tD t t,j ubX)W)XW) PuW) ubX) u* vU) Pvw vQ vt wyj Pwa) wP> w4e x Px\b xx  xU yQ PyQ yyj yv zBIE Pz$z zhT z֫3 {:2 P{3 {hT {֫3 |:2 P|3 |}{ |(d` }dJ P}0? }9? }hT ~֫3 P~:2 ~3 ~hT ֫3 P:2 3 hT ֫3 P:2 3 Ѐ"@{ |x PZj ' Ё5 Zn P_' _' Ђ>" @" Pm 2. Ѓ` s PV] U] Єb*- LM P, rA Ѕ # PbS V?H Іo! No! P|P V& ЇV?H 4> PV& ضc Ј:' JY< PX< Zj Љ& x& PV?H 4> ЊC! {P P{P  ЋaS  P 2G Ќ1 8' PnH 4aS Ѝ` u PV] U] Ў2j, 6f, P C> Pf 7 У7 ` PV] M Фj, nH PH .$+ ХEH nH PҬ0 dS ЦDH * P8DH J) ЧBH ?H PZ<% 8m! Шl! o! PD! l! ЩM {1 Pw1 ضc Ъbd5 S] PD! HU% Ыo% l! PnH M Ь{1 w1 P) Zj ЭNo! LjA P|P V& ЮV?H 4> PCy vJy Яm! i! P * аH .$+ P~. .` бt) ~8' Pe5 S] вnH K. Pt)  & г & Pp& v' дP9' 8DH PJ) BH е?H 1 P3' V& ж F. D! Pl! M з{1 w1 Pt) D! иl! M P{1 w1 йضc :' PJY< 1' к1 S- P@A? D! лHU% |% Pl! nH мM {1 Pw1 o! нNo! ? PrA # оs! Y< PJY< X< пX< Zj P 0 & & Px& x& Y< V?H P4> 4> C! {P P{P  aS  P teS ( 2G P1 8' H. nH P4aS  | D[ P` s V] U] PU] {1 B! w1 PnH 0? D! l! P&6 M 1 F P|  { 4 @A P"0 4e g5 D5 PD5  4e f PS] <{ ?  PD ]* [* d$ PTZ* " (" aH P, `> ~7 D\* P$ (o$ "0  P " g{ p7 PHS ~E S RtK P0|S L 0 , Pjc Y< d{I  P:n+ DM DM ~zI P= G% S]  P hT ֫3 H P^-  =c :2 3 P7 m' vm' fT| P 8B 8s & P& 2 & I% H% PH% DM } [' PhT 4e  ~7 ͆ 7 P֝  DJ ֻ P7 dQ. v' ' P  +@ &N [ P2G 1 c@ S PS <4 4e g Pq^ vC] 4e J P|  0!nH p!U+ ! ! 0".? p"4e "^J ",K 0#HKy p#HKy #j #<6 0$hT p$֫3 $D+ $:n+ 0%8` p%<4 %M %4e 0&' p&4e &' &j? 0'v' p'1 'D! 'l! 0(M p({1 (w1 (C> 0)f p)7 )֝ ) 0*DJ p*? *ֻ *NM. 0+EH p+JU +D[ +1 0,*M- p,1 ,? ,rA 0-# p-s! -m! -i! 0. p.* .` .V] 0/V p/, /P /nH 00H p0.$+ 0~. 0.` 01teS p1H. 1P9' 18DH 02J) p2BH 2?H 2D! 03HU% p38x% 3l! 3', 04@A? p4nH 44' 4M 051 p5f7Q 5rA 5# 06s! p6) 6? 6m! 07i! p7 7? 7H 08.$+ p8.` 8teS 8H. 09P9' p98DH 9J) 9BH 0:?H p:) : :^5 0;S] p;D! ;HU% ;o% 0<l! p<nH <M <{1 0=w1 p=` =s =V] 0>U] p>P >P >P 0?C> p?f ?C> ?f 0@7 p@7 @` @V] 0AM pA, ALM AnH 0BH pBEH BnH BҬ0 0Co! pCNo! CD! Cl! 0DM pD{1 Dw1 Dt) 0E~8' pEM- E@A? Eb1 0FD! pFHU% F|% Fl! 0G.` pGnH G2G G1 0HM pH{1 Hw1 Hh5 0IS] pInH I"P. It) 0J & pJ J& Jp& 0K0 pKdS Kv' KDH 0L* pL8DH LJ) LBH 0M?H pMN0 M? M.& 0NjU< pN Nc NH 0OEH pO0 OҬ0 O&+ 0PrA pP7 P~8' P& 0Qb1 pQD! QHU% Q8x% 0R1 pRl! R]5 RS] 0SnH pS~. S& SM 0T1 pT֝ T޷ TD 0Ub' pU? US U & 0VH& pV V& V& 0Wp& pW# WR0 W0 0XP pXdS X Xֻ 0YHM, pY2G Y1 Y:' 0Zv' pZ8DH ZJ) ZBH 0[?H p[>H [>H [>H 0\>H p\? \.$+ \.$+ 0]$0 p]t) ]t) ]Y< 0^' p^' ^@;H ^ 0_:2 p_3 _"# _4e 0`ڡ8 p`" e|& e"# 0fڡ8 pf.` f4e f®8 0gE/ pg.'5 gS] gD5 0h\7 phf hH7 h%7 0iD5 piz iX4 i4e 0j4 pjDJ j jv 0k pkx k` ks 0lV] plU] lV-, l@A? 0mdJ pm0? m m m@{ 0nR[w pn4rw n8 nyw 0o{ po1 oD! oHU% 0pƅ% pp1 pl! p~. 0qQF pqM q1 qC> 0rf pr\7 rC> r? 0sf ps7 s7 sEH 0tZj ptZ7 t<1 t - 0uz<. pu8' u? u 2 0vHU%vHU%vf.vvA0dU%Bt  0wHU%vHU%wf.wwX dU%Bt 0x px x:n+ x> 0yb py֫3 yL7R yzN.``k`P{{O O {z@|O  0{.`k`` f.{{qd ? vz|||4{` O @ |,f.}}qd ? `}rG" } }`C ~hT `~\S ~2 ~2 D! `HU%vHU%f.vdU%  `x% ܆v܆f.@@vdx܆a ܆v܆f.00pJdx܆ D! %v%@ f.;+tdU%.m %HU%vHU%Pf.g `U%f (o$ 02 pb1 hT ֫3 0o' pN`p`VPЇO O P@O  ``0  O  Јp@@@@@f.` @ @ v0 4Ј0 O @  Q Df.ppjIEd  Q 08 Tx `AN;`` AN;`` A @8)0 tS f7Q / @/ / / / @R T Tj \N3 \N3 @\N3 >`0 g w @n{zvn{zf. *ŕd .`I`\ =ެ= = @ ? S @A @" I '8 "]h @RF S ^![ 6 @v 6 1^1l! da Pn{zvn{zЖЕf.߹d0.ppz";`_ <6,f.00d 6 5 g ИCC  P2 2 ЙD! %v%pf.КК[mdU% .m 0%HU%vHU%f.`U% f @ G% 2 n{zvn{z`f.[4Kd. `^ p܆ ~d 1v1pPf.T"d! .m ^1v^1pf.РР .md!   02v2f.ССZ~d2Bt 0J) p? .` 2 0܆v܆f.УУc^ dx܆  ܆ `vХ4p0 0O @ ` if.d  2 ܆v܆ f.``dx܆  ܆ f 0D! p%v%Ш0 f.00?dU% .m %HU%vHU%f.@@v`U% f  2 HU%vHU%@f.wLkdU%a HU%vHU%@f.O dU% a J) lc `.`  2 HU%vHU%@f.^;brdU% HU%vHU%@f.̜dU% Њ< ,i p, ,  02G p1 J25 ~+5 0lc p.y8 B8 b( 0^> p4e  HKy 0[ pw w D! 0HU%vHU%f.ееdU%  0x% pO3vO3ж?f.00qd0;3? &z зda 2v2pf.hZd2;Bt |& PnH x йx 2 P@;H @;H к@;H  , P :2 лx  p_S P7? .? мHKy | P֫3 x н܆v܆0f.ppFdx܆ ܆v܆ f.``dx܆ 1^1l!  2 @HU%vHU%f.det dU% @HU%vHU%f.8dU% @ I M `a5  2 @HU%vHU%f.CdU%Bt ; @HU%vHU%f.|EǜdU%;Bt @3  ^ ` x @>A 2G 1 % @U ~d 4ev4e f.``O 5v e&& g Zn @da 2 & q+ :62 @$g Ba 2G 1 @B! $0 QF ^, @<2 2 ܆v܆ f.``Hkxdx܆ ܆ n^ 0n^ pf  {- 0- p `C ? 0=T p<4 4 4e 04e pf f f 0x p' lR `* 0.y8 p{- - dh' 0#8 p( |p, HKy 0I p>c 1v10f.pp=Ud!.m ^1v^1P0f.Ud! 1^1l! @1v10 f. -d! .m `^1v^10 f.  KJv?d!   D! HU%vHU% f.``g dU% x% ب^ @t0 &6 G% " @444d?y ^p:2 4y%b(9p~d01D!P^14eO3pب^0yi.a1`1` 23hTPP3L7RPn{z _^\P `K    Vjj?"`4?@@??#`*`+`,`-` 4] 4](]f.  `@*`*& 0  P @0  0  P: 0`ps`s` Йd.`O ڪwr & `P @ `KP 00    0    0  `P X@S`Q (O qԫrf.  O ;Zv @ТT3,` f.``*- a`Z!  pf.  P4XaPp`Z! . 0   P4](] : _^\P @zzz)( ('@'&`&%%%$0$#P#"p""! ! @ `@`0Pp @`00P p     @  `    0Pp @`0PPp @``Pp @`` 4Hae@ @4 O @f.@@ƋR`.4 8P @4@ @ @v1f.P )F5v614 @ @4  @ @4  @ @4P.mZ! @ @4@.P @4h.@ @4M.@ @4P2.P @4\.@ @4R.P @4Pc.P @40. Q @v62f.yG` !4P=.Q @4 0 @ @v1 f.``3Q Qvv610 4P 0 @ @4p 0 @ @4 0 @ @4.mZ! @ @4Ц.8Q @4*.@ @4Pk.@ @4^.@Q @4@l.@ @4p.NQ @4@>.fQ @4P.~Q @40@ @v1f.Q v614@ @4@ @4Ђ@ @4.mZ! @ @4.Q @4`1.@ @4Z.@ @4<.Q @47.@ @40.Q @4`.Q @4p.Q @4}.Q @40.R @4(.(R @46.@R @4.mZ! @ @4.mZ! @ @4P.@ @43.@ @4q.@ @4.mZ! @ @4.@ @4$.@ @4`.@ @4p.mZ! @ @4`.@ @4P?.@ @44.@ @4@.mZ! @ @4t.@ @48.@ @4s.@ @4| XR @40&rR @vy Pf.dޙdP 4~R @*P 4P0R @*pf4&R @*pf4pbS @40;[cS @4O[cS @4: S @4p `T @4 rT @4`_4U @4X_>U @4^LU @4a^VU @4P\dU @4pL\nU @4`w|U @4@U @4u@U @4YU @4Y"V @4@YV @4`]@ @4@[@ @4y V @4 @ @4@@ @40@TW @4``W @*4XY@|W @ p@4W @4Y @4Z! (Y   @4P.mZ! @ @4P.mZ! @ @4о.8Y @4.@Y @4~.@ @4@{Bt @ @4Bt @ @4.mZ! @ @4.mZ! @ @4.HY @4.PY @45.@ @4[Bt @ @4pmBt @ @4P.mZ! @ @4P.mZ! @ @4 Bt @ @4xBt @ @4Bt @ @4@w.mZ! @ @4@v.mZ! @ @4@Bt @ @4`dBt @ @4p'Bt @ @ );;;@ ` ~-`|zyw0vPtr0U`pnlk@iged`b`^f ]`[YXUSQ@PBNLJH0G0E@CA?> <:08p642E0/ -P+)'&P$" 0P0 op 0 ` P p@`@@0`  p ``  P0 В P@pp}{y`v t0r@p`npljhfd@b``0^@\PZ`XpVTRQNLJpHpFD@B@@<:p86421/P-+)@'@%@#!p@0 `    0PP@P0ppP@0зPЪ``@ 0`ЕP@``~|ywtsPqomljPhf@dpb `0^p\ZX W@UpSQpOPL0IFPDB@ >P<:87P53N`!`)4hY \Y 4p4@XY  4`!`f.0505kY . vd2N`!`Y6Y tY P6 6@pY  6`!`f.66Y vd2N`p\`}`8Y Y 87@Y  08)`U``\`f.88Y rv)pLN`p\`~ :Y Y 99@Y  9R`[`)`\`f.`:`:Y Pv)NNR`P`/;Y Y ;P;@Y  ;R```[``f.0<0<|DT`ȻmNT`P`.=Z Y P= =@Y  =T```[``f.>>`tmN|` V``@\ (Z ?>@Z  P?!!!o`hg*g``gZ ``Z `.g`^`}`Z ;`?`` Z ` `````5`|`V`c`f.@@&ï`~pL.N` ` BP\ :\ AA@6\  B.``f.`B`BS\ נ3nN```Cr\ \\ C`C@X\  C.``f. D Du\ Enp N` `E\ ~\ PE E@z\  E.``f.EE\ np$ N` `H\ \ GF@\  @G`G`2/ HpHG,Gr`n``j`\  \ f.IIy@dc0N```K\ \ 0JJ@\  `JJ`2/ KKJ,K````\  \ f.0L0Lidc N` `O\ \ PM M@\  MM`NNM, N`=`&`"`!`'` \  \ f.POPO)dc % N/``P] \ pP@P@\  PJ`/``QPf. Q QF!&n@Qz.Q07M!Q`Z! .N` [`S] ] RR@]  R``[`f.PSPS`Z QN``:T] ] pT@T@]  T````f.UU^`hPQ"N``/V] ] @VV@]  pV!` `J````f.VV``|l0n.N?``*X] ] XW@]  PX!` `J``?``f.XX] kv0nN<`P` @Z ^ ] YY@]  Z<``f.ZZ1F`VDmH/N<`P` \.^ ^ [[@^  [A`<``f.@\@\]h3`VDmH/.N<`P`]D^ 6^ p]@]@2^  ]8`<``f.^^ϋM`VDm(/N<`P`_^ \^ 0__@H^  `_`T^ L^ K``7`<``f.__b`VDm(/.N ``pa^ ^ a`@^  PaJ` ``Pbaf.aa!J!:!az.0b07M!Pb`Z! .N ``c^ ^ pc@c@^  c `J`` `!``f. d d^ *>v:!0nN=``$e$_ _ @ee@_  pe=`J`` ``f.ee'_ .Յv_0nN ``Pg@_ 0_ gf@,_  0gJ` ``0hpgf.ggjl!P_Fgz.h07M!0h`Z! .N ``if_ H_ Pi i@D_  i `J``!``f.iii_ avP_F0nNK``k_ r_ kj@n_  @k  `8`K````D```f.kkUu@`>PjNK`P``m"` _ ml@_  0m6``A`K``f.mmM`>mN3`P` o6` *` nn@&`  o3``f.`o`otl`(mN3`P`pl` >` pPp@:`  p```3``f. q q>f`(mN3``5r` v` Pr r@r`  r3``f.rr` ~v(0nN:` `@Pt` ` ts@`  0t:``f.tt`x_.N:`` vxa ` uu@`  u`^`}`` `o`hg*g``g` `` `.gE`:``c`f.vvIv.`x_PjN:`P`s`xa a xw@a  0x`J``:``f.xx`x_x`yxpyn.@y_J!`yp`Z! NN:`P`{{b a zPz@a  z`J``:`]``a a a `{a o`hg*g``ga `a `.g`if.||t#G`x_ ||@|p`|n.|jJ!|p`Z! pLN`!`[P~b b }}@b  ~b b R`b `!`f.~~2}`ej.N`!`9  c c @b  W`c c `!`f.``B.`ej. N`!`+Lc 2c `@$c  X`,c (c `!`f.00?`ej.N`G `oЃc Tc `0@Pc  c``\``9``f.00aP`". =]a`Z! @pN``1@c c @c  ``c `f.`u`PPQ"N``k`c c @c  $``k`f.@@c Lv` N` `c c `0@c  `f.ԝdP4,0N` `@c c Њ@c  0}`f./l-dP4, % N``` d d p@c  Ќ`f.  ;dP4, N` ` d d @@d  p``f.ЎЎLd(0N` `@4d (d @$d  }``f.Bd( % N```Hd e @@6e  p`f.РР8e P np p p p f.@@Rd@ N` `0de Xe `0@Pe  `f.Re ]eBnp$ p$ p$ p$ p$ p$ f.pp&Ŗd@ % N9` V`e le `@he  N``L`V`f.00XV`pL.N9` V`e e `0@e  V`f.e SvpLN ```qf e Ч@e  0  (`7`!`"`$`%`&`'`(`)`*`+``f.f @vg N ``%`4f (f @$f  @``f.7f 0vgiPN ``& Lf @f Ы@``f.f ovvwS0nN6`P`0f f @f  ]`` ```6``f.pp1R.h`,)mN6`` g f `@f    ``^`}`f 8``6``c`f.``T`,)PjN6``ж6g &g P@"g  J`6``f.00ew !,)Pz.07M!`Z! .N6``0Pg >g и@:g  !`J`6``f.ppSg u{v,)0nNE`` g \g `@Xg    `S`G`H`Q```I`E``f.```HPjN``мg g P@g  ```f.`)PjN`P`>g g 0@g  ````f._`)mN``0g g @g  ```f.ppӏ `)PjN`P`g g `@g  ```f.  W`)mN``h g @@g  p```f.4`)PjN` [`N@h h @h  ``[`f.`) VN`P`74h $h p@ h  ```f.00έ`)mN` [`Lh ```f.[`|m(/NL``i i 0@i  `J``pf.O|!|z.P07M!p`Z! .NL``i i `@i  J``f.@@ó!|`z.07M!`Z! .NL``@i i @i  8``K``f.}`|PjNL`` j i @i  `8`H``f.PP`|Pj^XcNL``?bj j P@j  J`!`<`6``f.  o?{`|0nNL``6j jj P @fj  J`<`!``f.j @ Xv|0nN8``pj j @j  @`8```f.ѐ`0PjN8`P`0j j @j  ``8``f.ppc@t`0mN8``k j `@j  J`A`@`?`8`` f.``8/!0z.07M!`Z! .N``>Pk k @k  0```f.op` bPjNA``@0Zk "k @k  `:``9``8`5``f.pp4k`hsPjNA` [`Onk bk `@^k  `[`f.  `hs VNA` [` l vk @@rk  p``````"`-`^```[`#`f.00`hsNA`` l l P @l  `f.#l n@^vhs0nNA` V`I@:l ,l @(l  `V`f.=l }*vhspLNA` V`I~m Zl p@Bl  !!!N`o`hg*g``gPl ``Jl `.g`]`S``x`.``!```5``0`-``Fl `V`f.  m EX2vhspL3 NR``m m P @m  ``f."`PjNR`P`Un m @m  @  ``` `^`m a``D2`f.$`mN0`p\``&n n @ n  @``\`f.; \` ?.@pN0`p\`0Ln 6n @*n  ``2n .n \`f.ppڏ` ?.PNw``pn hn p@Pn  ``8`````dn ``````n \n Xn `Tn `f..G`.PjNw``>o o @n  o `n n *`n n )`n #`"`n n n `f.G_\#!. z.`07M!`Z! .Nw`p\`Zo lo p@Bo  `i``R``ho do `o \o x``^``p`f`n`.`Jo Fo \`LNo gRo  @f."d`.@pNw`J `p p 0@o  `#`p o `f. `.Ps Nw` V`k^p s ,s P@(s  ```f.0a9`qjL0.N;`5`s Hs @@Ds  p  A`u`````<`;`5`~qA`u````f.@@e`qjL*.N`q ` $t s p@@s    ````````q````f.``A`qjL} .N`  `t 2t `@.t  ````p````@```~q`````X``f.u`qjLK pLN`0 ` t t @t  0   ``.``` ```X ``f.  L`qjL pLNR`FF`"vu u "!@u  @"  `````f`"S`R`F`~q````f`f.##L6`qjLk.N``{$u u @$$@u  p$```$```X``f.%%p-0`qjLl.N` [`&v u @&&@u  p&`C+``&``[`D`f.''t`qjLpWrN` [`' )v v @((@v  p(`C+````````(``[`~q`````f.`)`)#`qjLpWN` [`J*v v *p*@v  *``[`f.0+0+`qjLpWp+*N` [`K,v v ,`,@v  ,``[`f. - -\Yg`qjLpWN` [`L.w v P. .@v  .``[`f...ʰ`qjLpWN%`G `0x rx ==@nx  =  '``````j `W`P>```q'```W` @>@>f.??P+r!qjL ?@?"pl.?8Q)! @.?a@`Z! .`Z! .NK`p.` A*y x @AA@x  pAL``AO`K`.`DL`f.BB?B`qjL0H/H/N`` V`aDy 6y @CC@2y  pC  X``````Q`C\```V`~qX`````f.@D@D+1O`qjLP.N``G `CEy y EPE@y  E````f.FF`qjLPPF.*&N``G `CGy y pG@G@y  Gb````f.HH`qjLPPH..*&N``M0JJ+&"N)`G `pNz z MM@z  NR```N'`)``DR`f.NN}`qjL.NW`J ``P { z OO@z  P``PPU`W``D`f.PPV{`qjL .P.NH`G $`qPR({ { RQ@{  0R`H`$`f.RR`qjLR.Np`G _``0TB{ 2{ SS@.{  T`p`_`f.pTpTV%`qjLP"Np`G _``UZ{ J{ UpU@F{  U`p`_`f.0V0V `qjLP".Np`G _``W{ b{ pW@W@^{  Wj`W`p`_`Dj`f. X X^`qjLP"..N` V`Y{ { `Y0Y@{  Y``V`f.YYx`qjL.0Z.N`G `\[{ { P[ [@{  [```f.[[`qjL \.*&N`G `\]{ { @]]@{  p]```f.]]`qjL^..*&Nq`E b`_J| { 0__@{  `_  A`u`````_`q`b`~qA`u````f.0`0``qjL mN`G `al| Z| `a0a@V|  a```f.aaq`qjLP6 b.N``c| t| @cc@p|  pc'```c```D'`dcf. d di!qjL `d.pl.d8Q)!d`Z! .N`G `0f| | ee@|  f``f.pfpfE`qjLpLf.N``Ph} | gg@|  g``W`0h```X`W`f.hhoC`qjLJ""N``7 j*} } ii@}  j```f.`j`j`qjL>J+""N``BkD} 4} kpk@0}  k```f.0l0ld`qjL0""N` V`m`} N} pm@m@J}  mT``V`f.nn `qjLП.@n.N`G ` o|} j} `o0o@f}  o```f.ooiRj^`qjL`A p.N!`G `q} } @qq@}  pqR``q`!``DR`f.rr5`qjL`N`G `s} } 0ss@}  `sR``s```DR`f.ss'`qjL`NP` V`u`~ } ut@}  Pu  X````Q`I`J`uB`P`V`~qX```I`J`f. v vb-`qjLmN```x r~ `w0w@n~  w'``````````` ` x ```H'````````yxf.xxzpaqjL y"".@y}Ba`y`Z! .N;`J `{b 0 zPz@,  z<`F`zH`;``X<`F`f.P{P{`qjLp ..N`G `)|~ l |`|@h  |```f. } }`qjL`P}.NS`J `~  p~@~@  ~``~P`S``D`f.00+Ư`qjL .p.NZ`J $`q  `@  Y`Z`$`f.  ӝ`qjL P.NR`G `9  p@@  `R``f.QR`qjLp..NR`G `9  @@  p`R``f.ЄЄ?`qjLp...NR`G `9^  @  @  ``````R``q````f.|@d`qjLp....NR`G `| l P @h  `R``f.`qjLpp..NR`G `p  @  P`R``f.`qjLpp...NR`G `P  Ћ@  0R``f.`qjLpp....NR`G `p  @   ```P`R``n```f.` qjLpp.....N` [`E`  @  @``[`f.N`qjLn..N` [`HP2 " Б@  0``[`f.`qjLn. VN6`p.`Y@b < Г@8  L`0J`6`.`DL`f.`qjL`%H/H/N` V```ȁ l @h  ````@``V`n```f.^`qjL\p$ H/N)` V`10 ԁ @Ё  ````p`)`V`n```f.ИИd`qjL0[p$ N`p\`ip < @8  P``R```\`X`R`f.j`qjLO..N`p\`p | 0@x  ``\`f.p`qjLON`p\`pƂ  @  ``R````\`X`R`f.`qjLO.N ``h Ђ П@̂  0`-`p9` ``D`D2`f.РР "`qjL0p.N```_P  С@  0```f.6H`qjL N```e0  @  ```f.PP`qjL N```gХF 8 P@4  ``f.D]`qjL ..N```g^ N P @J  ```f.W`qjL ...N`p\`px h @d  P``\`f.R>`qjL@R.N`p\`@  @|  ``\`f.pt`qjL@R..N`p\`  @    ``X```W``````\`~q`X`W```f.ЭЭfd`qjL@R...N` V`/"  @   P```V`f.<,`qjLMPjN` V`/@: * @&  ``V`f.`qjLMPj.N` V`/` B @>    ````Q`@r``V`n```f.4`qjLMPj..N(`J ``  @    ]``)`*````(``f.)3I`r `pn.@jJ!`p`Z! pLN(`J `h  P@  `)`*````(``f.@@?p`r pLN` [` r `0@n  `[`f.`0.....PP0p.aкW.!P0`Z! rb`Z! p*I+N` [`ȅ  `@  `[` f.``apW`Z! rb`Z! *I+N` [`P ԅ о@Ѕ  0``[`f.!`pWrN` [`'  @  ```[`f.PP _`pWN` [`J  P@  ``[`f.`pW@*N` [`K2 " `0@  ``[`f.$£`pWN` [`L`H : @6  @``[`f.xSdpWN(`J `[~ N @J  (``f.PP 7 `.....0R|zaP{ .^! `Z! .b`Z! .`Z! .N(`J `[p  @  P(``pPf.Bea | pPs P `Z! .b`Z! .`Z! .N(`J `f  @  2`0`(``f.PP]4d | N(`J `fȆ  p@@  0`(``f.5` | .N(`J `fp܆ І @̆  P(``f.E, ` | ..N(`J `f0  @  "`(``f.pp) ` | ...N\`P` H  p@  \``f.00n`........^a n.`\ !b`Z! .c`Z! @pN\`P` n \ @X  \``0Pf.%gaPob`Z! .c`Z! @pN\`P`'p  @|  P\``@ f.$aPo@ b`Z! .c`Z! .N` [`qЇ  `0@  `[`f.`0.....P.ap.!`Z!  VN` [`q  0@܇  ``[` f.a .@T?`Z!  VN+``6  @@  p+``f._`.....0.p_{az. !`Z! .N+```V F @B  @+`` f.az *`Z! .N+``p d @@`  p+``@f.az @*"`Z! .N+`` x `0@t  +```f.az@`"*"`Z! .N+``  P@  +``f.00azp""*"`Z! .N+``Ĉ  @  +`` f.``az"""*"`Z! .N``Q0j Έ @ʈ  ``f.pp}`................0.pBapl.9!`Z! .N``Q`  @  @```f.tNal`...`Z! .N``sƉ  P@  ``f.00]oal""`Z! .N``s ԉ p@Љ  ```````0f.ppu'al"".`Z! .N``{0  @  ```f.pp5'`l.N``(  `@  ``f.  ʑ`PQN``> 0 @@,  p``f.FuZ`PQ"N``@T F @B  ``f.dhdPQN``| ^ @Z  ``f.@@`PQ..N``  p@@  ``f.ldPQiN`p`p  @  P``f.QqaQdN<`!`%   @  <`!`f.``'`.N<`!`% Ċ `@  <`!`f.  `..N` V`F  P @  `V`f.`\Z 0Y.*@ *N` V``   ` 0 @  ``V`f.  qH`\p$ H/N` V`F P  0  @  ` `V`f.  MI`\....N2`!`HPj \  @X  02`!`f.@`@.N2`!`H  v @r  2`!`f.``o`@....N` V`  p@  `V`f.00`c P*3 N` V`܋ Ƌ p@@‹  `V`f.R5x`c .N`p`}p  @  P``f.`dN9`!`U   @  9`!`f.```..N` V`>  `@   V`f.WdRXc0YN``uZ $ 0@   `  +`.`1`&``C+`t0`0```f.` 0*N``mr b P @^  ``f.m-d ?ЕN``m ~ 0@z  ```f.n"` ......N``u` ، ̌  @Ȍ  @ ``f.  7vd N``! " ތ !!@ڌ  !````f.`"`"- dvPN`p\`b#2  #P#@  #`\`f.$$6`O.....N`p\`v%P > P% %@:  %%`\`D`f.%%j{`O.N`p\`sp'f X '&@T  @'`V``\`f.''&CdON`p\`p0)| l ((@h  )```\`f.p)p)ts`O.N`p\`p*  *p*@  *`\`f.0+0+=`ON`p\`i,  P, ,@  ,```\`f.,,(`O..N`p\`bp.  .-@  P.`\`f...`OP0M..*@pN`p\`tp0 ΍ 0/@ʍ  @0`0`\`D`f.00[`OH/N`p\`uP2  11@  2@2``\`D`f.22“`O"N`p`V44  33@  3``f.P4P4D` ....N `J `5N @ 5`5@<  5 ``f. 6 6`y P6*gN `J `7v X p7@7@T  7 ``f.88F`y ..N `J `9Ǝ  099@|  `96`N`  `7` ``f.99l9 `y .N`p\``;ގ Ύ ;:@ ʎ  @;`\`f.;;` @RP0M.N)<3*NN`p\`p=L  =<@   P=`\`f.==B"|L` @R.........N`p\``?h \ ?>@X  @?`\`f.??`Zd@RN`p\`A~ n @@@j  @``\`f.PAPAlv`@R.N`p\`B  BPB@  B``\`f.CCG `@R..N`p\`D  @DD@  pD`````\`f.DD&`@R...N` V`Fҏ  0FF@   `F`V`f.FF}b` MPjpLN N` V`/H  0HH@  `H```V`f.HHe`MPjN` V`/@J   II@  J``V`f.JJ3&`MPj.N` V`/L&  KK@  KQ`r``V`f.PLPL0~*`MPj..N` V`M . MPM@ *  M`V`f.NN(\% ` M...........N``O  OPO@  O``f.PPl`..N;`!`6Q֐ ʐ @QQ@Ɛ  pQ;`!`f.QQNtdN;`!`6@S  RR@ܐ  S;`!`f.SSs`.N```HT  TpT@  T``f.0U0U`yd p YN```H Wȑ , VV@(  W``f.`W`Wf` ................N```_PY  YX@ޑ  0Y```f.YYd N```e[  ZZ@  Z```f.@[@[\+d N```g\  `\0\@   \``f.\\Ti` ..N```gp^2 " ^]@  P^```f.^^X` ...N)` V`10`J : __@6  ``)`V`f.p`p`7G`0[p$ N)` V`bb T aa@P  a)`V`f.@b@b_pd0[N`p`cv j `c0c@f  c``f.ccfdN/`p\``e ~ ed@z  @e``\`f.eeԗ` }@pN` V`g  ff@  f`V`f.PgPgCd4 N` V`hҒ  hPh@  h`V`f.iiB`4 ..N `` j ܒ @jj@ؒ  pj ``f.jjgF6d0pnN `` `l$  lk@  @l ``f.ll`0p....N ``0n: 0 mm@,  n ``f.pnpn|d0p0nN ``hpX B o`o@>  o-`o9` ``D2`f.@p@p4R`0p.N` `qv ` `q0q@\  q``f.qq➒dgN"`J ``s ~ sr@z  @s"``f.ss`z 0tw w tss *Ps *Ps *y N"`J `uޓ  Pu u@  u"``f.uu7i@`z ......N"`J `w  0ww@  `w"```f.ww#2`z .N"`J `0y  xx@  y"`  `f.pypy_dz N(` V`?|z2 $ z`z@   z(`V`0Yvy{0{4z0Y6 @f.{{=5dYf.@|@|=5dYN.``k`}f H `}0}@D  }.`k`f.}}Bx` ..N`p`Hp~ p ~@l  P``   p@@@@@v ~@4 @  f.@@ ed v ~4p0 @ `Qf.dQf.00`@ N`p`Hʔ  `0@  ``f.D`..N`J `p Ԕ @Д  P``f.D&`0v t .N`J `@  @  ``f.~`0v ....N_` `.8 * @&  _``f.PPd8 &hN_` `.Ћ^ @ P@<  _``f.By = @=< ; f`9 "#p 765    1 20 6/  .- , 3+ #/g28 ~@5 2 q(K  )B  :'#_2 @ (K&02 #X !  f ,-y&(4<'+%" =   ;1-97A*,6/@>B .#3)!?$ 258:0638Z!9638 A }!P7?/#96389638,m? #self#args638&( + *. %!#,-"$ ' )6381 =========================== HTTP Error message: k I A9638-.9638!9638 I A!9638.-9638- 7 ?/#96389638,d/#96389638,e/#96389638,f/#96389638,g/#96389638,h/#96389638,l/#96389638,m?#self#excbuf0/opt/julia/packages/HTTP/sJD5V/src/Exceptions.jlڻ HTTP.StatusError Raised when an `HTTP.Response` has a `4xx`, `5xx` or unrecognised status code. Fields: - `status::Int16`, the response status code. - `method::String`, the request method. - `target::String`, the request target. - `response`, the [`HTTP.Response`](@ref) 0/opt/julia/packages/HTTP/sJD5V/src/Exceptions.jlڻ HTTP.RequestError Raised when an error occurs while physically sending a request to the remote server or reading the response back. To see the underlying error, see the `error` field. 0/opt/julia/packages/HTTP/sJD5V/src/Exceptions.jlڻ @try Permitted Error Types expr Convenience macro for wrapping an expression in a try/catch block where thrown exceptions are ignored. 0/opt/julia/packages/HTTP/sJD5V/src/Exceptions.jlڻm HTTP.TimeoutError Raised when a request times out according to `readtimeout` keyword argument provided. 0/opt/julia/packages/HTTP/sJD5V/src/Exceptions.jlڻ HTTP.ConnectError Raised when an error occurs while trying to establish a request connection to the remote server. To see the underlying error, see the `error` field. 638T- A 4A4w496387?/#9638^? #self#err638no permitted errors_+- F- I A }!P!M I-9638-e6-I96383- A 4963849638 496389638 I R9638.!_-! A }!P   49638 A 49638 A 4963849638 49638 A 49638  49638  A 49638496387++?/#9638 9638/#9638 9638/#9638 9638/#9638 9638?-#self#__source____module__exes#1exerrs 638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x,% " +) !'&$*#(   638 +-? -!M9638._6 496387 -96386 +%.!J49638.!M .!J49638.!M I  I-y -y I I- A 4A4k- A9638- - A 4A49638 A 4A4U A 496384C9638 A 49638! A 496384A9638"7#- A 4A4k%- A9638 A 4A49638'( A 4A4U) A 496384I9638* A 49638&+7,+-+-?/#9638 9638,9/#9638 9638,:/#9638 9638,=/#9638 9638,>/#9638 9638,?/#9638 9638,@/#9638 9638,I?5#self#__source____module__conditionmsgrslsrl638`tH? A!y96389638 A7?/#96389638,9?'#self#__source____module__condition638+8.wZ6+8.!J49638.Q4A6+7.!J49638-^.Q6+6.!J49638.!M -y - .v 9638.6+5.!J49638.!M.wZ-k6+3+.!J49638.!M.!J49638.v496386+4.!J49638.!M.wZ-k6+!3+&.!J49638.!M!.!J"49638.v#496386$+3.!J49638.!M&.O'4Q6(++7(.!J49638.!J49638.!M,-+-.!J49638-/4Q.Q.0717=7=7=7=7=7=+8+8?/#96389638,(? #self#ex638 =  () failed to ensure unknown ? I  I.O V6 I 96383 I  I  I A!y 9638.vG6 .9638b.9638b I Ay 9638963896389638-l7?/#96389638,/#96389638,/#96389638,/#96389638, /#96389638,#?<#self#msgcalling_funcnamelslrsrmsgcalling_funcname638Z H? AG7?/#96389638,?$#self#msgcalling_funcnamelslrs638W H? AGG7?/#96389638,?!#self#msgcalling_funcnamelsl638T H? AGGG7?/#96389638,?#self#msgcalling_funcnamels638Q H? AGGGG7?/#96389638,?#self#msgcalling_funcname0/opt/julia/packages/HTTP/sJD5V/src/Conditions.jlڻW @ensure postcondition [message] Throw `ArgumentError` if `postcondition` is false. 0/opt/julia/packages/HTTP/sJD5V/src/Conditions.jlڻV @require precondition [message] Throw `ArgumentError` if `precondition` is false. 638?- A 4A4k- A9638 A 4A49638 A 4A4U A 4963849638 A 496387 ?/#96389638,?+#self#__source____module__conditionmsg638`tH? A!y96389638 A7?/#96389638,?'#self#__source____module__condition638 () requires unknown ? I.OV6 I96383 I I A!y9638- 7 ?/#96389638/#96389638?.#self#msgcalling_funcnamecalling_funcname638#self#-g9638.Z40--g9638- A 4A49638 A 496384V7?/#96389638?#self#638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x2y/\'kG(CI68 43L*YtvxdSW"MhV-@?w{O%ueԍn;HXp<.q#+ FT}:ab~$,N cR1`g]K|AUsJP&97l5 Zf=o [0j !>D_Qzmi^ErB)638💀 closed🔜💀closing⏸ paused🔁 active🔗 open🔜🔗 connecting5+-9638-k67G!9638-9638 I-.Q96386 79638.Q96386 79638.Q9638679638.Q9638 6+79638 .Q9638 6+79638 .Q9638 6+796387++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?  #self#cs638O. L496387?/#96389638,?#self#6389638. K i. L49638. L49638. F-. L49638.!@9638 d. L49638.!J 49638. L49638 A     7?/#96389638 ,v?#self##unused#638+5?   . K9638 d.|6+9638 d- - - -  -  A K      I R   I.96383+9638. K i. F-.!@9638 d.!J 49638 I A  I I A9638 G.9638 d-9638 .9638 !9638 -  . K#$ I R%  .9638 d-9638 9638 . K i*- F>-+, A -9638 '() I.. w60+33+5.!N I. 37+5+5?/#9638 9638 ,t/#9638 9638 ,u/#9638 9638 ,y/#9638 9638 ,|/#9638 9638 ,~/#9638 9638 ,?b#sslupgrade#21poolrequire_ssl_verificationkeepalivereadtimeoutkwchost#23#22conntls638SSLV.!J963849638.9638 A i-! A9638>7?/#96389638,j?#self#chost0 (0  (0  (h (*08@HPQX` @ (080  (h (*08@HPQX` @ (080  (h (*08@HPQX` @ (08638 ? I  9638.O 96386 I -9638 I A9638.9638  .9638 .9638 -9638 I  . w 63.!N I . 7 ?/#96389638,_/#96389638,`/#96389638,b/#96389638,c/#96389638,d/#96389638,e/#96389638,f/#96389638,g?Q#sslconnection#20require_ssl_verificationsslconfigkwtcphostiosslconfig638SSL.!J963849638.96389638 A i-! A96387?/#96389638,[?#self#tcphost638SSL.!J963849638.9638-!M9638 A i-! A96387?/#96389638,M?#self#tcphost638 +? I  9638 -!M9638.O6 I A9638 I .9638 96389638 .  9638. K i- F-96389638 A  I  . w 6+3+.!N I . 7 ++?/#96389638,Q/#96389638,R/#96389638,U/#96389638,V/#96389638,W/#96389638,X?Y#sslconnection#19require_ssl_verificationsslconfigkwtcphostssl_streamsslconfig638...: SSL connect: 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl443+X? I9638-e6 I96383 I I      I96389638 I-!M9638.96386+< I9638 I# I A9638.9638O 9638V-9638k6+< I 49638 A963896389638   6 +< I 9638 .9638w 96386#+'!9638 I -% I +H V+. I A!y9638 9638 9638 I A i I> W3+3 W I  A!963896389638    > I= ~(6+< A!i.!@4 -!e566+: A963896389638    3+; A 5963896389638    3+<9638V A!i.!@=-!e>6?+C I A963896383+D I A >96389638 I A!i.!@E-!eF6G+Q A96389638 II. w6K+N3+P.!N I. N7 A F96389638 IQ. w6S+V3+X.!N I. V7+X+X?+/#96389638,G/#96389638,H/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,I/#96389638,J? p#getconnection#18kwhostporttcpmsgkwargslinefileidlogger_modulegroupstd_levellevelerrport638l A i-! A96387?/#96389638,B?#self#hostport638l A i-! A96387?/#96389638,7?#self#hostport638n A i-! A9638>7?/#96389638,?#self#hostport638...: SSL connect: 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl443+X? I9638-e6 I96383 I I      I96389638 I-!M9638.96386+< I9638 I# I A9638.9638O 9638V-9638k6+< I 49638 A963896389638   6 +< I 9638 .9638w 96386#+'!9638 I -% I += V+. I A!y9638 9638 9638 I A i I> W3+3 W I  A!963896389638    > I= ~(6+< A!i.!@4 -!e566+: A963896389638    3+; A 5963896389638    3+<9638V A!i.!@=-!e>6?+C I A963896383+D I A >96389638 I A!i.!@E-!eF6G+Q A96389638 II. w6K+N3+P.!N I. N7 A F96389638 IQ. w6S+V3+X.!N I. V7+X+X?+/#96389638,</#96389638,=/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,>/#96389638,?? p#getconnection#17kwhostporttcpmsgkwargslinefileidlogger_modulegroupstd_levellevelerrport638CURL_CA_BUNDLEHTTP_CA_BUNDLE+-96389638.963896386+9638963896389638 A I-96389638.!M96389638.   I. w63.!N I. 73+&.963896386+&9638963896389638 A I-96389638.!M96389638. I. w6 +#3+%.!N I. #7-!M9638 I&. w6(++3+-.!N I. +7+-+-?/#96389638 ,)/#96389638 ,*/#96389638 ,+/#96389638 ,,/#96389638 ,-/#96389638 ,./#96389638 ,//#96389638 ,0/#96389638 ,1/#96389638 ,4? #self#sslcontext638CURL_CA_BUNDLEHTTP_CA_BUNDLEp+,9638-!M9638.OV6-9638>.!x9638-9638=.!x9638.963896386 96389638-!M963896389638.!M96389638.- .  3+.963896386+96389638-!M963896389638.!M96389638.-.6+%-!M9638 I. w6+"3+$.!N I. "7-!M9638 I%. w6'+*3+,.!N I. *7+,+,?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 , /#9638 9638 ,!/#9638 9638 ,"/#9638 9638 ,#/#9638 9638 ,%?"#self#require_ssl_verification638failed to connect...: TCP connect: 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl+s?    9638-e6 I-+P3 I. I . w63.!N I.  I   I96389638 I-!M9638.96386 +E I9638 I# I A9638.9638O9638V-9638k%6&+E I49638 A9638963896386)+E I9638 .9638w96386,+0!9638 I-. I+ V+7 I A!y9638 9638  9638 I A i I> W3+< W I  A!963896389638> I= ~16+E A!i.!@=-!e>6?+C A963896389638 3+D A >963896389638 3+E9638V96389638 I -F I -96389638 I -!PI. O ?-!ZK6L+l I. LN. LN V+c96389638 I.RS 6+X-96383+X W IX. w6[+^3+`.!N I. ^7 W3+g W I  I  ~Q I .!PIP. O ?-!Zh6i+l3+N-U Il. w6n+q3+s.!N I. q7+s+s?+#/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,/#96389638, /#96389638, /#96389638, /#96389638, /#96389638, /#96389638,/#96389638,/#96389638,/#96389638,?  !!"""""#######getconnection#16keepalivereadtimeoutkwhostporterraddrspmsgkwargslinefileidlogger_modulegroupstd_levellevelerraddrtcpe638.!J49638!9638.Q6-7=7>?/#96389638,/#96389638,/#96389638,/#96389638,? #self#tcp638%failed to set keepalive on tcp socketN+!9638 A V+ I+!9638-. Ko.!J49638.!`.!`C.!`9638. Ko.!Y  .!YC .!Y9638 I S49638$$49638    !9638.9638 W3+ W I!9638 A. O6+ A!7?++?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,?#self#tcpmsg638? A9638 A!49638.9638 d-96386 I3 IV A9638 7 ?/#96389638,/#96389638,?(#releaseconnection#15poolkwcreuse638nV A i-! A96387?/#96389638,?#self#creuse638k. L49638-.96387?/#96389638,? #self#c638<+0. L49638. L49638. L49638. L49638. L49638. L49638.|6+!9638 d. L49638-  . L49638- . L49638- . L49638- . L49638-  A K   . L49638. L49638. L49638. L49638. L49638 I R. L49638 I.96383+.9638 . K i!. L49638. L49638. F#$-"%. L49638.!@&'9638 d. L49638. L49638 I A ()*+, A9638 .7/+0+0?/#9638 9638 ,? #self##106389638. K i. L49638. L49638. F-. L49638.!@9638 d. L49638. L49638 A     7 ?/#96389638,?#self##unused#638+?-96389638 d- - - - -  -  -  A K   I R    .9638 d A F  >9638. K i9638- . K I R. F- A 96387++?/#96389638,/#96389638,?#newconnection#8poolconnection_limitforcenewidle_timeoutconnect_timeoutrequire_ssl_verificationkeepalivekwhostport#11#9638SSLVV--!M9638.!J963849638.9638 A i-! A9638=>7 ?/#96389638,?#self#hostport6385)` and pass to each request like `pool=POOL` instead.Q)` before any requests are made or construct a shared pool via `POOL = HTTP.Pool(dconnection_limit no longer supported as a keyword argument; use `HTTP.set_default_connection_limit!(1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl +7?.OV67  I 96389638 I   -!M9638.96386+6 I 49638 I # I A9638   .9638O9638V-9638k6+6 I49638 A963896389638   6+6 I9638.9638w96386+!!9638 I- I+ V+( I A!y9638 9638 9638 I A i I> W3+- W I  A!963896389638     > I= ~"6+6 A!i.!@.-!e/60+4 A963896389638   3+5 A /963896389638   3+69638V76+7+7?+/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,? L#self#clmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638-96386-9638 I.f3 I= I63-7?/#96389638,/#96389638,/#96389638,?#self#cidle_timeoutcheck638BH-V7?/#96389638,?#self#638+2.OV6+-!M9638-9638-!M9638-9638-!M9638-9638 I9638-!c V+ I+9638-!M9638-9638.9638 W3+ W I-!9638. O6+ A!3+2.!J49638-9638.!J49638 -9638.!J49638 -9638 I.!J4c-!c V+, I+9638.!J49638 -9638'.9638&( W3+. W I-!9638. O6/+2 A!7?+2+2?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#59638,/#59638, /#59638, /#59638, /#59638, /#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#59638,/#59638, /#59638, /#59638, /#59638, /#9638 9638 ,? #self#pooltemptemp638v. K9638 d. L49638.!J4-7?/#96389638,?#self#638i. K9638 d-!M9638-7?/#96389638,?#self#638N-!M96387?/#96389638,?#self##unused##unused#638N-!M96387?/#96389638,?#self##unused##unused#638N-!M96387?/#96389638,?#self##unused##unused#638E +C. K9638 d d96389638.O6.!J49638 I. w6 3.!N I.  7 d96389638.O6+.!J49638 I. w6+3+.!N I. 7 d96389638.O6+'.!J49638 I. w6!+$3+&.!N I. $7 I.!J4c-!c V+6 I +9638 d-  A K+,- I R..!J49638 I A9638 01 d I W3+8 W I -!9638 . O 69+< A! I  . w 6=+@3+B.!N I . @ 7B+C+C?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#59638,/#59638, /#59638, /#59638, /#59638, ? ##self#pool#unused#temp#6638} I9638-!c V I+. K9638 d I R-!M9638 I A9638 d I W3 W I-!9638. O6 A!7?/#96389638,/#59638,/#59638, /#59638, /#59638, /#59638, ?##self##unused##unused#temp#46380bytesavailable(c)`bytesavailable(c) == 0``!(isopen(c.io))`+'.!J49638-9638-k-9638k6 06 I-963896383 I9638V.963896389638 -9638U .!J49638-9638-k6+.!J49638-96383.!J49638 A!4p.!J49638 A!49638 -9638 .Q-9638k6+' 06+! I-963896383+" I9638V-9638  A96389638 9638 "9638 #9638-9638U$7%7?+'+'?/#96389638,X/#59638,/#96389638,Y/#96389638,Z/#96389638,[/#96389638,\/#96389638,]/#96389638,^/#59638,A/#59638,C?  #self#c638`. L49638-96387?/#96389638,8?#self#638💀 Closed: 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlI+W V+;.!J49638-96386+9  I 96389638 I   -!M9638.96386+6 I 9638 I # I A9638   .9638O9638V-9638k6+6 I49638 A963896389638    6+6 I9638 .9638w96386+!!9638 I- I+$ V+( I.!y9638  I A i I> W3+- W I  A!963896389638     > I= ~"6+6 A!i.!@.-!e/60+4 A963896389638   3+5 A /963896389638   3+69638V.!J49638-7 W3+W W I  V+B.!J49638-> W3+P W I .9638w963896386D+H-96383+H!9638.9638wHI-9638J6K+N3+O-9638 ~=!9638.wPQ6R+U3+V A ~7V+W+W?+"/#96389638,#/#96389638,$/#96389638,$/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,%/#96389638,(/#59638,/#59638,/#59638,,/#59638,,/#96389638,)/#96389638,+?  !!!!!!P#self#cmsgkwargslinefileidlogger_modulegroupstd_levellevelerrexe638+ I.!J49638-9638.Q6 A!4p A!49638.!J49638-96386 A9638-U .!J49638-9638 I.D I.!J49638!9638. $.!J49638.!J49638.!J4p.X.  A9638 &.!J4p.X A!4p7++?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,? #self#csizehintnbuf638GH.+7?/#96389638,? #self#c638|-9638-k67-9638.|7?/#96389638,?#self#creadtimeout638: A9638.!J49638.[ I. w63.!N I.  7?/#96389638,? #self#c638a.!J49638-96387?/#96389638,,? #self#http%DXRU],1W/  ;>V509H*!KNTZ+O [\)MB=C:'<-P^  4?@(E6ISLA 78.FYJ3$Q&2"#G638 Site Frozen&CloudFlare Server Error: Railgun Error1CloudFlare Server Error: Invalid SSL Ceritificate*CloudFlare Server Error: Connection Failed"CloudFlare Server Error: A Timeout2CloudFlare Server Error: Origin Server Unreachable+CloudFlare Server Error: Connection Timeout+CloudFlare Server Error: Connection Refused CloudFlare Server Error: UnknownNetwork Authentication Required Not ExtendedBandwidth Limit Exceeded Loop DetectedInsufficient StorageVariant Also NegotiatesHTTP Version Not SupportedGateway Time-outService Unavailable Bad GatewayNot ImplementedInternal Server Error<nginx error or Antivirus intercepted request or ArcGIS errornginx error: HTTP -> HTTPS%nginx error: SSL Certificate Required"nginx error: SSL Certificate ErrorUnavailable For Legal Reasonsnginx error: No Response Login TimeoutRequest Header Fields Too LargeToo Many RequestsPrecondition RequiredUpgrade RequiredUnordered CollectionFailed DependencyLockedUnprocessable EntityMisdirected Request I'm a teapotExpectation FailedRequested Range Not SatisfiableUnsupported Media TypeRequest-URI Too LargeRequest Entity Too LargePrecondition FailedLength RequiredGoneConflictRequest Time-outProxy Authentication RequiredNot AcceptableMethod Not Allowed Not Found ForbiddenPayment Required Unauthorized Bad RequestPermanent RedirectTemporary Redirect Use Proxy Not Modified See OtherMoved TemporarilyMoved PermanentlyMultiple ChoicesIM UsedAlready Reported Multi-StatusPartial Content Reset Content No ContentNon-Authoritative InformationAcceptedCreatedOK Early Hints ProcessingSwitching ProtocolsContinue Unknown Codea+P I.96389638+ A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x9638 9638 A!x9638 9638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x9638 9638! A!x9638"9638# A!x9638$9638% A!x9638&9638' A!x9638(9638) A!x9638*9638+ A!x9638,9638- A!x9638.9638/ A!x9638096381 A!x9638296383 A!x9638496385 A!x9638696387 A!x9638896389 A!x9638:9638; A!x9638<9638= A!x9638>9638? A!x9638@9638A A!x9638B9638C A!x9638D9638E A!x9638F9638G A!x9638H9638I A!x9638J9638K A!x9638L9638M A!x9638N9638O A!x9638P9638Q A!x9638R9638S A!x9638T9638U A!x9638V9638W A!x9638X9638Y A!x9638Z9638[ A!x9638\9638] A!x9638^9638_ A!x9638`9638a A!x9638b9638c A!x9638d9638e A!x9638f9638g A!x9638h9638i A!x9638j9638k A!x9638l9638m A!x9638n9638o A!x9638p9638q A!x9638r9638s A!x9638t9638u A!x9638v9638w A!x9638x9638y A!x9638z9638{ A!x9638|9638} A!x9638~9638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x96389638 A!x963896387+P+P?+P/#96389638/#96389638/#96389638/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638, /#96389638,!/#96389638,"/#96389638,#/#96389638,$/#96389638,%/#96389638,&/#96389638,'/#96389638,(/#96389638,)/#96389638,*/#96389638,+/#96389638,,/#96389638,-/#96389638,./#96389638,//#96389638,0/#96389638,1/#96389638,2/#96389638,3/#96389638,4/#96389638,5/#96389638,6/#96389638,7/#96389638,8/#96389638,9/#96389638,:/#96389638,;/#96389638,</#96389638,=/#96389638,>/#96389638,?/#96389638,@/#96389638,A/#96389638,B/#96389638,C/#96389638,D/#96389638,E/#96389638,F/#96389638,G/#96389638,H/#96389638,I/#96389638,J/#96389638,K/#96389638,L/#96389638,M/#96389638,N/#96389638,O/#96389638,P/#96389638,Q/#96389638,R/#96389638,S/#96389638,T/#96389638,U/#96389638,V/#96389638,W/#96389638,X/#96389638,Y/#96389638,Z/#96389638,[/#96389638,\/#96389638,]/#96389638,^/#96389638,_/#96389638,`/#96389638,a?  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP #self#v5/opt/julia/packages/HTTP/sJD5V/src/status_messages.jlڻ statustext(::Int) -> String `String` representation of a HTTP status code. ## Examples ```julia julia> statustext(200) "OK" julia> statustext(404) "Not Found" ``` 1/opt/julia/packages/HTTP/sJD5V/src/StatusCodes.jlڻHThis module provides HTTP status code constatnts and related functions 638 Unknown Codej.!J4Q9638 A96387?/#96389638?#self#status     R A !963887@@`?'//#9638?638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x/+bkSQJ?O*GZ)1l:Dim9dE&CV3aBhW$Y'K4X5`<"A P0-gHUMf. j ]T =\8!I_^nR,e # F[c6L%;2>@N(7638o+ I     -e6+. F=73+ A9638.!l I. L I. L A!l I. L I. L A!l I. L6+%. F>7"3+%.Q96386%+s6>+r A9638.!l, I. L- I. L- A!l, I. L0 I. L0 A!l, I. L36+9. F>763+9.Q963869+<3+>. F=7< I A9638 A9638.!l? I. L@ I. L@ A!l? I. LC I. LC A!l? I. LF6+L. F>7I3+L.Q96386L+O3+Q. F=7O A9638.!lQ I. LR I. LR A!lQ I. LU6+Z3+\. F=7Z A9638.!l\ I. L] I. L] A!l\ I. L` I. L` A!l\ I. Lc6+g3+i.Q96386g+l. F>7i3+l.v96386l+q. F=7n3+q3+'3+.Q96386s+ I A9638 .!lv I. Lw I. Lw A!lv I. Lz I. Lz A!lv I. L}.v9638 6+ I6>+ A9638.!l I. L I. L A!l I. L6+3+. F=7 A9638.!l I. L I. L A!l I. L I. L A!l I. L6+3+.Q9638 6+. F>73+.v96386+. F=73+3+3+.Q96386+ I A96383+.f9638 6+ I.f9638 3+ I=6+3+.Q9638 6+ I-+:- .X I.[. Ko.!`o. Ko. K.!`9638. Ko.!Yo. Ko. K.!Y I S496389638(&((&49638.!M9638.[.[ I.X3+.Q96386+ A9638.!l I. L I. L A!l I. L I. L A!l I. L6+. F>73+.Q96386+3+. F=7 A9638.!l I. L I . L A!l I. L I . L A!l I. L6+. F>73+.Q96386+3+. F=7 A9638.!l I. L I . L A!l I. L I . L A!l I. L6+. F>73+.Q96386+3+. F=7)3+.Q96386)+< A9638.!l) I. L) I . L) A!l) I. L)  I . L)  A!l) I. L) 6+. F>7)3+.Q96386)+3+. F=7) A9638.!l) I. L) I . L) A!l) I. L) I . L) A!l) I. L)6+$. F>7)!3+$.Q96386)$+'3+). F=7)' A9638.!l)) I. L)* I . L)* A!l)) I. L)- I . L)- A!l)) I. L)06+6. F>7)33+6.Q96386)6+93+;. F=7)93+.Q96386)<+ A9638.!l)> I. L)? I. L)? A!l)> I. L)B I. L)B A!l)> I. L)E6+K. F>7)H3+K.Q96386)K+N3+P. F=7)N A9638.!l)P I. L)Q I. L)Q A!l)P I. L)T I. L)T A!l)P I. L)W6+]. F>7)Z3+].Q96386)]+`3+b. F=7)` A9638.!l)b I. L)c I. L)c A!l)b I. L)f I. L)f A!l)b I. L)i6+o. F>7)l3+o.Q96386)o+r3+t. F=7)r A9638.!l)t I. L)u I. L)u A!l)t I. L)x I. L)x A!l)t I. L){6+. F>7)~3+.Q96386)+3+. F=7)3+. F=7). F>7)++?+T/#96389638,4/#96389638,5/#96389638,6/#96389638,8/#96389638,;/#96389638,</#96389638,/#96389638,/#96389638,/#96389638,=/#96389638,>/#96389638,/#96389638,/#96389638,/#96389638,?/#96389638,@/#96389638,A/#96389638,B/#96389638,C/#96389638,D/#96389638,E/#96389638,H/#96389638,I/#96389638,J/#96389638,K/#96389638,M/#96389638,N/#96389638,O/#96389638,P/#96389638,Q/#96389638,R/#96389638,S/#96389638,U/#96389638,X/#96389638,Y/#96389638,[/#96389638,\/#96389638,]/#96389638,^/#96389638,_/#96389638,a/#96389638,/#96389638,/#96389638,/#96389638,b/#96389638,/#96389638,/#96389638,/#96389638,c/#96389638,/#96389638,/#96389638,/#96389638,d/#96389638,f/#96389638,/#96389638,/#96389638,/#96389638,g/#96389638,/#96389638,/#96389638,/#96389638,h/#96389638,/#96389638,/#96389638,/#96389638,i/#96389638,k/#96389638,/#96389638,/#96389638,/#96389638,l/#96389638,/#96389638,/#96389638,/#96389638,m/#96389638,/#96389638,/#96389638,/#96389638,n/#96389638,/#96389638,/#96389638,/#96389638,p/#96389638,r?  !!"########$%%%&&&&&&&&&&&&&'''''((*********+++,,,,.........///00002222222223334444557777777778889999;;;;;;;;;<<<====?????????@@@AAAABBDDDDDDDDDEEEFFFFHHHHHHHHHIIIJJJJLLLLLLLLLMMMNNNNPPPPPPPPPQQQRRRRSSTTB#self#bytesimaxlenbeofvptriaretreti638hH-^.D9638 A7?/#96389638,4?#self#bytesi638eH-^.D9638 A7?/#96389638,4? #self#bytes638? 49638 49638 A 4A4Q49638 49638 A 49638 A 49638496384963849638-7?/#96389638,? #self#__source____module__ch638w + I 6>+  A9638 .!l I. L I. L A!l I. L I. L A!l I . L 67 3.Q963867 3.Q96386+ A9638 .!l I. L I. L A!l I. L I. L A!l I . L37?+ + ?/#96389638,/#96389638, /#96389638, /#96389638, /#96389638, /#96389638, /#96389638,? #self#bytesimaxlenbeofi638* I I.X.6 A F>&73?.!M I I ? A F=7?/#96389638,/#96389638,/#96389638,/#96389638,?#self#bytesimaxlenvalbi638+ I6>+ A9638.!l I. L I. L A!l I. L I. L A!l I. L 6 A F>7 3.7963863+ A F=737?++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#bytesimaxlenbeofitext/plain; charset=utf-16letext/plain; charset=utf-16betext/xml; charset=utf-8application/json; charset=utf-8text/plain; charset=utf-8text/html; charset=utf-8638.!M-<.!M-<...!M-<.. .!M-< . +.  7?/#96389638,? #self#bmp4ftyp638+- I-!P. O?-!Z6+ I. L. L?.X.[ .!M .!M.Q 6 I3+7= I? I? I.!P . O?-!Z6+37>++?/#96389638,/#96389638,/#96389638,/#96389638,?#self#data1inddata2vali 638X-9638.!M7?/#96389638,? #self##unused#datafirstnonws638 +&-^.D9638.{ I-!P. O?-!Z6+& I. L. L I.!M.f&6 3+.Q& 63+.f&6+ I.f&3+ I=6+3+.f&6+ I .f&3+ I =6 +!7=3+! I.!P . O?-!Z"6#+&37>+&+&?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?'#self##unused#datafirstnonwsib638+--^._67=3-9638 I-..v 6 3-^._67=3 A963896386+3+7=.X A{ I-!P. O?-!Z6+- I. L. L.Q6 +$3+(3+$ A963896386$+(7>3+( I.!P. O?-!Z)6*+-3+7=+-+-?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? ,#self##unused#datafirstnonwsboxsizest638f +9-^.!J49638-^.X._67=3.!J49638-9638 I-!P . O?-!Z 6+.. L.!l I. L I. L A!l I. L. L.X.[ I .!M-9638A.f6+%-9638Z.f6 +$ I . &3+$3+%.v 6%+)7=3+) I.!P . O?-!Z*6++.3.!J49638-^..X/.!M0-9638 -9638>. F23.71465+83+97=7>+9+9?/#96389638,s/#96389638,t/#96389638,u/#96389638,v/#96389638,w/#96389638,x/#96389638,y/#96389638,z?"#self#hdatafirstnonwsbidb638 +5.!J496386 I 3 I  I.[.!J49638-^ .!J49638-^ .v  67=3-^.!J49638-^._6+7=3+.!J49638-9638 I-!P. O?-!Z6+5. L.!l I . L! I. L! A!l  I. L$. L.X .!M'.(.!J49638.!M* .v)+6,+07=3+0 I.!P&. O?-!Z162+53+7>+5+5?/#96389638,b/#96389638,c/#96389638,d/#96389638,e/#96389638,f/#96389638,g/#96389638,h?&#self#mdatafirstnonwsskmaski638+-^.!J49638-^._67=3.!J49638- I-!P . O?-!Z 6 + I. L. L.!J49638.!M.!M.Q6+3+7= I.!P . O?-!Z6+37>++?/#96389638,N/#96389638,O/#96389638,P/#96389638,Q/#96389638,R?#self#edatafirstnonwsi638text/html; charset=utf-8D79638?/#96389638,p? #self#h638P.!J496387?/#96389638,]? #self#m @638P.!J496387?/#96389638,K? #self#e 638application/json; charset=utf-8D79638?/#96389638,?#self##unused#638text/plain; charset=utf-8D79638?/#96389638,?#self##unused#638 video/mp4D79638?/#96389638,~?#self##unused#application/x-gzipapplication/zipPKapplication/x-rar-compressedRar  video/webmEߣ video/aviRIFFAVI audio/mpegID3 audio/midiMThdapplication/oggOggSOggS audio/basic.snd audio/aiffFORMAIFF audio/waveRIFFWAVEimage/vnd.microsoft.icon image/webpRIFFWEBPVP image/bmpBM image/jpeg image/pngPNG  image/gifGIF89a image/gifGIF87atext/plain; charset=utf-8text/plain; charset=utf-16letext/plain; charset=utf-16beapplication/postscript %!PS-Adobe-application/pdf%PDF-text/xml; charset=utf-8 String (mimetype) `HTTP.sniff` will look at the first 512 bytes of `content` to try and determine a valid mimetype. If a mimetype can't be determined appropriately, `"application/octet-stream"` is returned. Supports JSON detection through the `HTTP.isjson(content)` function. ## Examples ```julia julia> HTTP.sniff("Hello world!!") "text/plain; charset=utf-8" julia> HTTP.sniff("Hello world!!") "text/html; charset=utf-8" julia> HTTP.sniff("{"a": -1.0}") "application/json; charset=utf-8" ``` 638-9638-9638-^.D9638.{.!M-96387?/#96389638,9? #self#str638application/octet-stream<+ I-^._6.!M.796386 I.X39638 I-!P . O?-!Z6+ I. L. L A96386+-963873+ I.!P . O?-!Z6+379638++?/#96389638,</#96389638,=/#96389638,>/#96389638,?/#96389638,A/#96389638,B/#96389638,C/#96389638,D?#self#datafirstnonwssig638O I-9638-9638 I.9638-96386-96383-96387?/#96389638,1/#96389638,2/#96389638,3/#96389638,4/#96389638,5/#96389638,6?#self#bodydataalreadymarked@ (08 638\-9638-96387?/#96389638? #self#str63887=?/#96389638? #self#d63887=?/#96389638? #self#d638-^.|6Q.{.!M A!B9638-!a-6 7 Q.{.!M A!B 9638-!a-77=?/#96389638? #self#bytesPK638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x(0A;9&'?I%,J#5+2:>=)CH"K4! 6 /$7 HTTP.Multipart("File.txt", open("MyFile.txt"), "text/plain"), )) headers = [] HTTP.post(url, headers, body) ``` # Extended help Filename SHOULD be included when the Multipart represents the contents of a file [RFC7578 4.2](https://tools.ietf.org/html/rfc7578#section-4.2) Content-Disposition set to "form-data" MUST be included with each Multipart. An additional "name" parameter MUST be included An optional "filename" parameter SHOULD be included if the contents of a file are sent This will be formatted such as: Content-Disposition: form-data; name="user"; filename="myfile.txt" [RFC7578 4.2](https://tools.ietf.org/html/rfc7578#section-4.2) Content-Type for each Multipart is optional, but SHOULD be included if the contents of a file are sent. [RFC7578 4.4](https://tools.ietf.org/html/rfc7578#section-4.4) Content-Transfer-Encoding for each Multipart is deprecated [RFC7578 4.7](https://tools.ietf.org/html/rfc7578#section-4.7) Other Content- header fields MUST be ignored [RFC7578 4.8](https://tools.ietf.org/html/rfc7578#section-4.8) //opt/julia/packages/HTTP/sJD5V/src/multipart.jlڻ HTTP.Form(data; boundary=string(rand(UInt128), base=16)) Construct a request body for multipart/form-data encoding from `data`. `data` must iterate key-value pairs (e.g. `AbstractDict` or `Vector{Pair}`) where the key/value of the iterator is the key/value of each mutipart boundary chunk. Files and other large data arguments can be provided as values as IO arguments: either an `IOStream` such as returned via `open(file)`, or an `IOBuffer` for in-memory data. For complete control over a multipart chunk's details, an [`HTTP.Multipart`](@ref) type is provided to support setting the `filename`, `Content-Type`, and `Content-Transfer-Encoding`. # Examples ```julia data = Dict( "text" => "text data", # filename (cat.png) and content-type (image/png) inferred from the IOStream "file1" => open("cat.png"), # manully controlled chunk "file2" => HTTP.Multipart("dog.jpeg", open("mydog.jpg"), "image/jpeg"), ) body = HTTP.Form(data) headers = [] HTTP.post(url, headers, body) ``` 638 -- "&Content-Disposition: form-data; name="-- `eltype(d) <: Pair`*`match(boundary_re, boundary) !== nothing`]$ ]{0,69}[^[\w'\(\)\+,-\./:=\?+W? I 9638 A!y9638 9638 9638 I -9638.9638 .? V-9638k 6 + 06 I-963896383 I9638V.963896389638 -9638U-!.h-9638k6+! 06+ I-963896383+ I9638V.963896389638 -9638U I-!M9638 I A9638 I-^-9638  I-!P$. O?-!Z&6'+Q. L).!l* I. L+ I . L+ A!l* . L..!l/ I. L0 I . L0 A!l/ I . L3. L).Q67+; IG3+< I9638 As<96389638.[6= A!y96389638.[?@.w 9638 6B+J.9638 -9638.. I A9638 3+L.[9638.[ I.!P$5. O?-!ZM6N+Q3+) As963896389638.[QR-9638. A9638+7V+W+W?+/#96389638,j/#96389638,k/#96389638,l/#59638,/#96389638,m/#59638,/#96389638,n/#96389638,o/#96389638,p/#96389638,q/#96389638,r/#96389638,s/#96389638,t/#96389638,u/#96389638,v/#96389638,w/#96389638,x/#96389638,y/#96389638,{/#96389638,|/#96389638,~/#96389638,/#96389638,/#96389638,/#96389638,? F#Form#3boundarydleniodataboundary_rebcharsnospacevki638.w96386-9638-9638.[7-96387?/#96389638? #self#x638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x$# ! "    638v. L49638-. L49638.7?/#96389638,G? #self#x638H9638- -  A K I R I.9638.OV-k6 .96387??/#96389638,G/#96389638,H/#96389638,I/#96389638,K?#self#ckeq#9i638LH AQ7?/#96389638,G? #self#ck638a-. L49638.Q7?/#96389638,=? #self#x6389638- . K I R I.9638.OV67.!M.!M 7 ?/#96389638,=/#96389638,>?#self#ckdefault#7i638LH AV7?/#96389638,=? #self#ck638]..96387?/#96389638,4? #self#ckv638v. L49638-. L49638.7?/#96389638,)? #self#x638H I-9638- -  A K I R.9638.OV6 .7??/#96389638,(/#96389638,)/#96389638,*/#96389638,,?#self#citemeq#5k638LH AQ7?/#96389638,(?#self#citem638v. L49638-. L49638.7?/#96389638,? #self#x638H9638- -  A K I R I.9638.OV67.!M7 ?/#96389638,/#96389638,?#self#ckdefaulteq#3i638PH AQ7?/#96389638,?#self#ckdefault638NH AVQ7?/#96389638,? #self#ck+/opt/julia/packages/HTTP/sJD5V/src/Pairs.jlڻ setbyfirst(collection, item) -> item Set `item` in a `collection`. If `first() of an exisiting item matches `first(item)` it is replaced. Otherwise the new `item` is inserted at the end of the `collection`. +/opt/julia/packages/HTTP/sJD5V/src/Pairs.jlڻ defaultbyfirst(collection, item) If `first(item)` does not match match `first()` of any existing items, insert the new `item` at the end of the `collection`. +/opt/julia/packages/HTTP/sJD5V/src/Pairs.jlڻ getkv(collection, key [, default]) -> value Get `value` for `key` in collection of key/value `Pairs`, where `first(item) == key` and `value = item[2]` +/opt/julia/packages/HTTP/sJD5V/src/Pairs.jlڻ] setkv(collection, key, value) Set `value` for `key` in collection of key/value `Pairs`. +/opt/julia/packages/HTTP/sJD5V/src/Pairs.jlڻs getbyfirst(collection, key [, default]) -> item Get `item` from collection where `first(item)` matches `key`. +/opt/julia/packages/HTTP/sJD5V/src/Pairs.jlڻP rmkv(collection, key) Remove `key` from `collection` of key/value `Pairs`. 638t. L49638-. L49638.7?/#96389638? #self#x638`H I-9638- -  A K I R I.9638.OV6 .3 A!x7?/#96389638/#96389638/#96389638/#96389638/#96389638/#96389638?#self#citemeq#1ik638JH AQ7?/#96389638?#self#citem638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x!:r8[5;ehn7.IR`t ?pKd&jWwA$4 FSCyzӥvT1% \g+X|ؑc)3V#OBmb2s_{638J`Messages.statustext` is deprecated, use `StatusCodes.statustext` instead.!9638.963849638.!J963849638-7?/#96389638,y/#96389638,z?#self#status638. Ko.!`-.!`. Ko.!Y.!Y S49638$(&%49638.9638 7 ?/#96389638,X? #self#s638 I A9638.9638-9638--96387?/#96389638,Q/#96389638,R/#96389638,S? #self#mb638essage Body was streamed]`.!J49638-^.Q6.!J49638.!M.w96386.!J49638.!M .!J 49638.!J49638.!M .!J 49638.[.{.!M 779638?/#96389638,J/#96389638,K/#96389638,M? #self#body638essage Body was streamed]-96386-9638-9638-!M9638.D.{.779638?/#96389638,G? #self#body638a.!J963849638-7?/#96389638,H? #self#body638Q.!x96387?/#96389638,?? #self#x638+.!J963849638.9638 I-9638.Q6.!J963849638 I.9638.!M-9638 .v  6 --9638.9638 I. w6+3+.!N I. 7++?/#96389638 ,./#96389638 ,//#96389638 ,0/#96389638 ,1/#96389638 ,2/#96389638 ,5?#self#iomessagebytesn638+ I-9638.!l I. L I. L A!l I. L.!J963849638.O -k 6 +.9638-9638.!l I. L I. L A!l I. L37?++?/#96389638,!/#96389638,"/#96389638,#/#96389638,$/#96389638,%/#96389638,&?#self#bytesmhbytes638Q.96387?/#96389638,?#self#bytesr  (`0 000 638Q.96387?/#96389638,?#self#bytesr638.!J963849638.9638 I- I.9638.96387??/#96389638,/#96389638,/#96389638,/#96389638,?#self#iomessagebytes638 : T +.9638.!J49638 I-!P. O?-!Z6+. L.!l I . L I. L A!l  I. L . L-e-k6+ A[ 963896383+ I.!P. O?-!Z6+3.[9638-9638 I.[7++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?&#self#iombufnwrittenvaluename638j.!J49638 A96387?/#96389638,? #self#iom638f A9638 A96387?/#96389638,? #self#iom638  .!J49638.!J49638-y.!J963849638.!J49638- A[9638963896387?/#96389638,? #self#ior638  .!J49638.!J49638.!J49638 A[9638963896387?/#96389638,? #self#ior638gziph+. K.Q963869638.!J49638.9638 I. w63.!N I.  7.!J49638 I. w63+.!N I. 7++?/#96389638,/#96389638,/#96389638,?#self#mencoding638gzipOH.96387?/#96389638,? #self#m638 ISO-8859-1 Content-Type A9638963896386-9638-96387-9638-7?/#96389638,?#self#m#unused#638chunkedidentity, Transfer-Encoding+. K.96389638.96389638- I-9638 A!G96389638.76.!J49638 I . w6 3.!N I. 7.9638 I. w6+3+.!N I. 7++?/#9638 9638 ,/#9638 9638 ,?#self#menc638s.!J49638 A963896387?/#96389638,?#self#mheader638, Set-CookieE+# I.!J49638.!l I. L I. L A!l I. L.v96386+!-^.| 6 +!-!.!M .!M.Q 6+!-!.!M.!M-!.!M.!M Ay9638.-! A!x3+#.!J49638.!7?+#+#?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#mheadervkc638- A9638V.OV6.96387??/#96389638,/#96389638,/#96389638,? #self#mv638_ A963896387?/#96389638,? #self#hv8`6389638.!J49638.!J49638- F A }!P7?/#96389638,+?#self#httpa638.!J4-9638.!J49638-9638.9638 A963896387?/#96389638,? #self#hv638e.!J49638.96387?/#96389638,? #self#mv638,96389638.9638.96389638.!B A!B-!a-96387?/#96389638,? #self#mkv638w.9638-9638.96387?/#96389638,~? #self#mkv638Y.9638.vG7?/#96389638,w? #self#mk638m.!M. L49638.96387?/#96389638,n? #self#x638E.!M7?/#96389638,n? #self#x638y9638.!J49638- F A }!P7?/#96389638,)?#self#httpa638w. A96389638.!M7?/#96389638,e? #self#hkd638KH AG7?/#96389638,e? #self#hk638k.!J49638 A96387?/#96389638,d? #self#mkd638KH AG7?/#96389638,d? #self#mk638Q.96387?/#96389638,]? #self#ab6380Content-Length-96386 I9638. w63.!N I. 7 A963896389638.  I . w63.!N I. 7?/#96389638,P? #self#r638Content-LengthHEAD+4.!J49638.!J49638.Q96386 I. w63.!N I.  7-96386+ I9638. w63+.!N I. 7.!J49638.!++0.76+" I. w6+3+!.!N I. 7.96389638 I".v"G6$+.. I&. w6(++3+-.!N I. +7 I9638. w6/+23+4.!N I. 27+4+4?/#96389638 ,B?#self#rl638X.!J49638.vG7?/#96389638,5? #self#r638.!J49638.v6.!J49638.v+d77=?/#96389638,4? #self#r638chunkedtransfer-encoding.!M.963896386.!M-9638.9638963877=?/#96389638,+? #self#h638 I R9638.!J49638.96387?/#96389638,+? #self#m#4638+.!J49638-963867.!J49638 A KT9638i.w67.!J49638.w 6 9638.!J49638 I. 3 I=6+7.!J49638-96386+.!J49638-963877=++?/#96389638,? #self#r638:7=?/#96389638,? #self#x638!96389638. K d-9638 d A-^.|67.9638 d496387 ?/#96389638,? #self#x638a.!J49638-96387?/#96389638,#? #self#r638-96386-96386-9638-k6-963867-96386 7 -963877=7=7=?/#96389638, ? #self#r638i A F+++++++++W.77?/#96389638,$?#self#status638.!J49638-96386.!J49638.!J49638-963877=?/#96389638,c? #self#http638g.!J49638 AQ49638=7?/#96389638, ? #self#r638g.!J49638 AQ49638=7?/#96389638,? #self#r638g.!J49638 AQ49638=7?/#96389638,? #self#r638g.!J49638 AQ49638=7?/#96389638,? #self#r638a.!J49638-96387?/#96389638,? #self#r638DELETEPUT-963867.!96389638.77?/#96389638,?#self#method638g.!J49638 AQ49638=7?/#96389638,? #self#r638g.!J49638 AQ49638=7?/#96389638,? #self#r638p-96386-9638-k77=?/#96389638,? #self#r638a.!J49638-96387?/#96389638,? #self#r638.!J49638-96386.!J49638.!J49638-963877=?/#96389638,b? #self#http638] A F+-+.+/+3+4.77?/#96389638,?#self#status638a.!J49638-96387?/#96389638,? #self#r638.v6.v+d6.v+e6._+63.+,6 -9638-k 7 7=7=7=7=?/#96389638,?#self#status638a.!J49638-96387?/#96389638,? #self#r638TRACEOPTIONSHEADGET{ A!9638963896389638.77?/#96389638,?#self#method638O.L496387?/#96389638,? #self#r638O.L496387?/#96389638,? #self#r638O.L496387?/#96389638,? #self#r638<7?/#96389638,? #self#h638invalid header key-value pair: `-header must be passed as key => value pair: `+/9638-9638 I-!P. O?-!Z6+). L.!l I. L I. L A!l I. L . L.w6+ A!y96389638--U3+-^.v6+.!y9638--U3+.!M-y-9638.!M-y-9638 .! A!x" I.!P. O?-!Z%6&+)3 I. w6*+-3+/.!N I. -7+/+/?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#hheadersheadi638pH. K9638-^..7?/#96389638,? #self#h638#?/x+.!J49638-e6 I96383 I.!J49638.!J49638-e-k 6 I96383 IG.!J49638.!J49638-e-k6+ I96383+ IG.!J49638 Ay7++?/#96389638,?#self#uri` 638/+?  -9638 6 I-9638 3 I I .Q G6 I96383 I -9638  9638. K i- F- A 9638 I A9638.!J 49638 A!49638 7 ++?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,?U#Request#3versionurlresponsebodyparentcontextmethodtargetheadersbodyrb638O.L496387?/#96389638,? #self#r638O.L496387?/#96389638,? #self#r638O.L496387?/#96389638,? #self#r638O.L496387?/#96389638,? #self#r638b-9638.96387?/#96389638,o? #self#mk638 I R96389638- . K I R.9638.7 ?/#96389638,m?#self#hk#7#6638O.L496387?/#96389638,? #self#r638.9638 A!49638 A!49638.!J49638-e-k6.!J49638-9638.!J49638.!J 49638.9638 496387??/#9638 9638 ,{/#9638 9638 ,|/#9638 9638 ,}/#9638 9638 ,~/#9638 9638 ,/#9638 9638 ,? #self#r638?9638. K i- F- A 96387?/#96389638,p?)#Response#2bodyrequeststatusheaders638*request isa Request || request === nothingn ?-96386 I -96383 I .96389638 I .w96386 3.OV6 3-!l9638-!U-9638 A96387?/#96389638 ,j/#96389638 ,k/#96389638 ,l?4#Response#1versionrequeststatusheadersbodyb./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ HTTP.appendheader(::Message, key => value) Append a header value to `message.headers`. If `key` is the same as the previous header, the `value` is [appended to the value of the previous header with a comma delimiter](https://stackoverflow.com/a/24502264) `Set-Cookie` headers are not comma-combined because [cookies often contain internal commas](https://tools.ietf.org/html/rfc6265#section-3). ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻh"The presence of a message body in a response depends on both the request method to which it is responding and the response status code. Responses to the HEAD request method never include a message body []. 2xx (Successful) responses to a CONNECT request method (Section 4.3.6 of [RFC7231]) switch to tunnel mode instead of having a message body. All 1xx (Informational), 204 (No Content), and 304 (Not Modified) responses do not include a message body. All other responses do include a message body, although the body might be of zero length." [RFC7230 3.3](https://tools.ietf.org/html/rfc7230#section-3.3) ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ/"The presence of a message body in a request is signaled by a Content-Length or Transfer-Encoding header field. Request message framing is independent of method semantics, even if the method does not define any use for a message body." [RFC7230 3.3](https://tools.ietf.org/html/rfc7230#section-3.3) ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ^ HTTP.setheader(::Message, key => value) Set header `value` for `key` (case-insensitive). ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ readheaders(::IO, ::Message) Read headers (and startline) from an `IO` stream into a `Message` struct. Throw `EOFError` if input is incomplete. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ writeheaders(::IO, ::Message) Write `Message` start line and a line for each "name: value" pair and a trailing blank line. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ HTTP.decode(r::Union{Request, Response}) -> Vector{UInt8} For a gzip encoded request/response body, decompress it and return the decompressed body. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻS HTTP.removeheader(::Message, key) Remove header for `key` (case-insensitive). ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻP headerscomplete(::Message) Have the headers been read into this `Message`? ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻI retryable(::Request) Whether a `Request` is eligible to be retried. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻeThe `Messages` module defines structs that represent [`HTTP.Request`](@ref) and [`HTTP.Response`](@ref) Messages. The `Response` struct has a `request` field that points to the corresponding `Request`; and the `Request` struct has a `response` field. The `Request` struct also has a `parent` field that points to a `Response` in the case of HTTP redirects that occur and are followed. The Messages module defines `IO` `read` and `write` methods for Messages but it does not deal with URIs, creating connections, or executing requests. The `read` methods throw `EOFError` exceptions if input data is incomplete. and call parser functions that may throw `HTTP.ParsingError` exceptions. The `read` and `write` methods may also result in low level `IO` exceptions. ### Sending Messages Messages are formatted and written to an `IO` stream by [`Base.write(::IO,::HTTP.Messages.Message)`](@ref) and/or [`HTTP.Messages.writeheaders`](@ref). ### Receiving Messages Messages are parsed from `IO` stream data by [`HTTP.Messages.readheaders`](@ref). This function calls [`HTTP.Parsers.parse_header_field`](@ref) and passes each header-field to [`HTTP.Messages.appendheader`](@ref). ### Headers Headers are represented by `Vector{Pair{String,String}}`. As compared to `Dict{String,String}` this allows [repeated header fields and preservation of order](https://tools.ietf.org/html/rfc7230#section-3.2.2). Header values can be accessed by name using [`HTTP.header`](@ref) and [`HTTP.setheader`](@ref) (case-insensitive). The [`HTTP.appendheader`](@ref) function handles combining multi-line values, repeated header fields and special handling of multiple `Set-Cookie` headers. ### Bodies The `HTTP.Message` structs represent the message body by default as `Vector{UInt8}`. If `IO` or iterator objects are passed as the body, they will be stored as is in the `Request`/`Response` `body` field. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jl:ڻe set_show_max(x) Set the maximum number of body bytes to be displayed by `show(::IO, ::Message)` ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ Are `field-name`s `a` and `b` equal? [HTTP `field-name`s](https://tools.ietf.org/html/rfc7230#section-3.2) are ASCII-only and case-insensitive. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻP write(::IO, ::Message) Write start line, headers and body of HTTP Message. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ` writestartline(::IO, ::Message) e.g. `"GET /path HTTP/1.1\r\n"` or `"HTTP/1.1 200 OK\r\n"` ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ HTTP.headercontains(::Message, key, value) -> Bool Does the header for `key` (interpreted as comma-separated list) contain `value` (both case-insensitive)? ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻY ischunked(::Message) Does the `Message` have a "Transfer-Encoding: chunked" header? ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ HTTP.Response(status, headers::HTTP.Headers, body; request=nothing) HTTP.Response(status, body) HTTP.Response(body) Represents an HTTP response message with fields: - `version::HTTPVersion` [RFC7230 2.6](https://tools.ietf.org/html/rfc7230#section-2.6) - `status::Int16` [RFC7230 3.1.2](https://tools.ietf.org/html/rfc7230#section-3.1.2) [RFC7231 6](https://tools.ietf.org/html/rfc7231#section-6) - `headers::Vector{Pair{String,String}}` [RFC7230 3.2](https://tools.ietf.org/html/rfc7230#section-3.2) - `body::Vector{UInt8}` or `body::IO` [RFC7230 3.3](https://tools.ietf.org/html/rfc7230#section-3.3) - `request`, the `Request` that yielded this `Response`. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻo defaultheader!(::Message, key => value) Set header `value` in message for `key` if it is not already set. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻ HTTP.Request( method, target, headers=[], body=nobody; version=v"1.1", url::URI=URI(), responsebody=nothing, parent=nothing, context=HTTP.Context() ) Represents a HTTP Request Message with fields: - `method::String` [RFC7230 3.1.1](https://tools.ietf.org/html/rfc7230#section-3.1.1) - `target::String` [RFC7230 5.3](https://tools.ietf.org/html/rfc7230#section-5.3) - `version::HTTPVersion` [RFC7230 2.6](https://tools.ietf.org/html/rfc7230#section-2.6) - `headers::HTTP.Headers` [RFC7230 3.2](https://tools.ietf.org/html/rfc7230#section-3.2) - `body::Union{Vector{UInt8}, IO}` [RFC7230 3.3](https://tools.ietf.org/html/rfc7230#section-3.3) - `response`, the `Response` to this `Request` - `url::URI`, the full URI of the request - `parent`, the `Response` (if any) that led to this request (e.g. in the case of a redirect). [RFC7230 6.4](https://tools.ietf.org/html/rfc7231#section-6.4) - `context`, a `Dict{Symbol, Any}` store used by middleware to share state ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻi HTTP.header(::Message, key [, default=""]) -> String Get header value for `key` (case-insensitive). ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻb HTTP.hasheader(::Message, key) -> Bool Does header value for `key` exist (case-insensitive)? ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻp HTTP.hasheader(::Message, key, value) -> Bool Does header for `key` match `value` (both case-insensitive)? ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻI issafe(::Request) https://tools.ietf.org/html/rfc7231#section-4.2.1 ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻO isidempotent(::Request) https://tools.ietf.org/html/rfc7231#section-4.2.2 ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻE"request-target" per https://tools.ietf.org/html/rfc7230#section-5.3 ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻD iserror(::Response) Does this `Response` have an error status? ./opt/julia/packages/HTTP/sJD5V/src/Messages.jl)ڻmRead chunk-size from an `IO` stream. After the final zero size chunk, read trailers into a `Message` struct. ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻI isredirect(::Response) Does this `Response` have a redirect status? ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlBڻT bodysummary(bytes) The first chunk of the Message Body (for display purposes). ./opt/julia/packages/HTTP/sJD5V/src/Messages.jlڻc HTTP.headers(m::Message, key) -> Vector{String} Get all headers with key `k` or empty if none 6389638. K i.49638>- F- A 9638b7?/#96389638,E? #self#x638N A !96387?/#9638,2? #self#x638R A !96387?/#9638,2?#self#mapexprx638Z. 963896387?/#96389638,2? #self#x638P.!J496387?/#96389638,~? #self#c638_? A9638GG=7?/#96389638,{?5#Connection#1require_ssl_verificationkeepaliveio638.!J49638.!J49638.!J49638.!J49638.!J49638 A F7?/#96389638,o? #self#x638q9638.!J49638.96387?/#96389638,c? #self#c1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻ_Read until `find_delimiter(bytes)` returns non-zero. Return view of bytes up to the delimiter. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻTThis module provides the [`newconnection`](@ref) function with support for: - Opening TCP and SSL connections. - Reusing connections for multiple Request/Response Messages This module defines a [`Connection`](@ref) struct to manage the lifetime of a connection and its reuse. Methods are provided for `eof`, `readavailable`, `unsafe_write` and `close`. This allows the `Connection` object to act as a proxy for the `TCPSocket` or `SSLContext` that it wraps. [`POOLS`](@ref) are used to manage connection pooling. Connections are identified by their host, port, whether they require ssl verification, and whether they are a client or server connection. If a subsequent request matches these properties of a previous connection and limits are respected (reuse limit, idle timeout), and it wasn't otherwise remotely closed, a connection will be reused. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻj closewrite(::Connection) Signal that an entire Request Message has been written to the `Connection`. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻ newconnection(type, host, port) -> Connection Find a reusable `Connection` in the `pool`, or create a new `Connection` if required. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻA purge(::Connection) Remove unread data from a `Connection`. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻ startread(::Connection) 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻ connectionkey Used for "hashing" a Connection object on just the key properties necessary for determining connection re-useability. That is, when a new request calls `newconnection`, we take the request parameters of host and port, and if ssl verification is required, if keepalive is enabled, and if an existing Connection was already created with the exact. same parameters, we can re-use it (as long as it's not already being used, obviously). 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻ startwrite(::Connection) 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻP HTTP.Pool(max::Int=HTTP.default_connection_limit[]) Connection pool for managing the reuse of HTTP connections. `max` controls the maximum number of concurrent connections allowed and defaults to the `HTTP.default_connection_limit` value. A pool can be passed to any of the `HTTP.request` methods via the `pool` keyword argument. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻ closeall(pool::HTTP.Pool=nothing) Remove and close all connections in the `pool` to avoid any connection reuse. If `pool` is not specified, the default global pools are closed. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻWait for `c` to receive data or reach EOF. Close `c` on EOF. TODO: or if response data arrives when no request was sent (isreadable == false). 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻ flush(c::Connection) Flush a TCP buffer by toggling the Nagle algorithm off and on again for a socket. This forces the socket to send whatever data is within its buffer immediately, rather than waiting 10's of milliseconds for the buffer to fill more. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻi closeread(::Connection) Signal that an entire Response Message has been read from the `Connection`. 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jlڻ Connection A `Sockets.TCPSocket`, `MbedTLS.SSLContext` or `OpenSSL.SSLStream` connection to a HTTP `host` and `port`. Fields: - `host::String` - `port::String`, exactly as specified in the URI (i.e. may be empty). - `idle_timeout`, No. of seconds to maintain connection after last request/response. - `require_ssl_verification`, whether ssl verification is required for an ssl connection - `keepalive`, whether the tcp socket should have keepalive enabled - `peerip`, remote IP adress (used for debug/log messages). - `peerport`, remote TCP port number (used for debug/log messages). - `localport`, local TCP port number (used for debug messages). - `io::T`, the `Sockets.TCPSocket`, `MbedTLS.SSLContext` or `OpenSSL.SSLStream`. - `clientconnection::Bool`, whether the Connection was created from client code (as opposed to server code) - `buffer::IOBuffer`, left over bytes read from the connection after the end of a response header (or chunksize). These bytes are usually part of the response body. - `timestamp`, time data was last received. - `readable`, whether the Connection object is readable - `writable`, whether the Connection object is writable 638.!x96389638.!J963849638. K-.!x96389638.!J963849638. K- .!x9638 9638.!J963849638 . K  -.!x9638 7??/#9638 9638 ,1/#9638 9638 ,3/#9638 9638 ,4/#9638 9638 ,5/#9638 9638 ,6? #self#n638+.!J963849638 A.s..!x9638.!J963849638.!J963849638 A-.!x9638 9638.!J963849638 . K  -!M9638- .!x9638 9638.!J9638 49638. K-!M9638-.!x9638 9638.!J963849638 . K-!M9638-.!x96387?++?/#96389638,(/#96389638,)/#96389638,*/#96389638,+/#96389638,,/#96389638,-?#self#638SH A9638-7?/#96389638,?#self#638-9638.96389638. K i. F- A y7?/#96389638,? #self#t638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x+-9638-.Q69638963873 V96389638.!J49638 I.  -^.9638  W7 W I .w96386+3+ A-!M ~7++?/#96389638,>/#96389638,?/#96389638,@/#96389638,A/#96389638,B/#96389638,D/#96389638,G?#self#httpfbytesexnr!jEFkhZ*df%214A_LN =`M>X6G9;3q($W W3+8 W I  A!9638 96389638    > I= ~'6+A A!i.!@9-!e:6;+? A96389638 9638   3+@ A :96389638 9638   3+A9638V I96389638 I-!M9638 .9638LM6N+t I9638  I# I A9638 .9638O9638V-9638kS6T+t I49638 A96389638 96386W+t I9638.9638w96386Z+^!9638 I-\ I+\ V+f.!J49638 I.!y9638` I A i I> W3+k W I  A!9638 96389638> I= ~_6+t A!i.!@l-!em6n+r A96389638 96383+s A m96389638 96383+t9638V7>7=+v+v?+3/#96389638,W/#96389638,Z/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,\/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#96389638,]/#96389638,_?  !"""#$$%&&''(+,,-...../000000000123#self#httpmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638+ I-9638.Q96386-9638-k6.9638 I.X 33+-9638-k 6+-9638 A9638 I.X37++?/#96389638,./#96389638,//#96389638,0/#96389638,1/#96389638,2/#96389638,6/#96389638,7/#96389638,8/#96389638,:? #self#httpbufn638WH A9638.7?/#96389638,.? #self#http638? +# I-9638 I-.Q6 I. w63.!N I.  73.!J49638.!J496386+ I3+ I.X.D A9638 I.D.9638 I . w 6+!3+#.!N I . !7 +#+#?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#httppnntrn6380 http.ntoread`http.ntoread >= 0`+?.!J49638.v96386.!J49638.[ A!49638.!J496386.!J49638.Q 6 A!496389638.!J49638.-9638k6+ 06+ I-963896383+ I9638V.!J49638 A96389638963896389638-9638U77?++?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#59638 ,A/#59638 ,C?#self#httpn638?.!J49638-9638-k6-9638.!J49638.Q96386.!J496386 .!J49638.!J49638.9638  A!49638.!J496387?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? #self#http638✅ Continue: -/opt/julia/packages/HTTP/sJD5V/src/Streams.jl 100-continueExpect +A.!J49638 A9638963896386+A.!J49638-9638-k6.!J49638-9638  I 96389638 I   -!M9638 .96386+< I 9638  I # I A9638    .9638O9638V-9638k6+< I49638 A96389638 9638   6+< I9638.9638w96386"+&!9638 I-$ I+ V+..!J49638 I.!y9638( I A i I> W3+3 W I  A!9638 96389638    > I= ~'6+< A!i.!@4-!e566+: A96389638 9638   3+; A 596389638 9638   3+<9638V.!J49638-9638+d.9638=>7?7?+A+A?+/#96389638,/#96389638,/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,? N#self#httpmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638✅ Continue: -/opt/julia/packages/HTTP/sJD5V/src/Streams.jlq+<.!J49638.!J49638.Q+d6+<  I 96389638 I   -!M9638.96386+7 I 9638 I # I A9638   .9638O9638V-9638k6+7 I49638 A963896389638    6+7 I9638 .9638w96386+!!9638 I- I+ V+).!J49638 I.!y9638 # I A i I> W3+. W I  A!963896389638    > I= ~"6+7 A!i.!@/-!e061+5 A963896389638   3+6 A 0963896389638   3+79638V.!J49638 .!J49638.9638897:7?+<+<?+/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,? N#self#httpmsgkwargslinefileidlogger_modulegroupstd_levellevelerr6380 +.!J496386+= A!49638 V.!J49638.[9638 W7 W I .9638w963896386 -96383!9638.9638w-96386+ ~7-9638 ~77?++?/#96389638,m/#96389638,n/#96389638,o/#59638/#59638/#59638,/#59638,?#self#httpe638d.!J49638.!J496387?/#96389638,<? #self#http638x.!J49638.!J49638. 96387?/#96389638,;? #self#http638.!J49638.!J49638 A!496387?/#96389638,*?#self#httpstatus-/opt/julia/packages/HTTP/sJD5V/src/Streams.jlڻ> closebody(::Stream) Write the final `0` chunk if needed. -/opt/julia/packages/HTTP/sJD5V/src/Streams.jlڻy isaborted(::Stream{<:Response}) Has the server signaled that it does not wish to receive the message body? "If [the response] indicates the server does not wish to receive the message body and is closing the connection, the client SHOULD immediately cease transmitting the body and close the connection." [RFC7230, 6.5](https://tools.ietf.org/html/rfc7230#section-6.5) -/opt/julia/packages/HTTP/sJD5V/src/Streams.jlڻo100 Continue https://tools.ietf.org/html/rfc7230#section-5.6 https://tools.ietf.org/html/rfc7231#section-6.2.1 -/opt/julia/packages/HTTP/sJD5V/src/Streams.jlڻk Stream(::Request, ::IO) Creates a `HTTP.Stream` that wraps an existing `IO` stream. - `startwrite(::Stream)` sends the `Request` headers to the `IO` stream. - `write(::Stream, body)` sends the `body` (or a chunk of the body). - `closewrite(::Stream)` sends the final `0` chunk (if needed) and calls `closewrite` on the `IO` stream. - `startread(::Stream)` calls `startread` on the `IO` stream then reads and parses the `Response` headers. - `eof(::Stream)` and `readavailable(::Stream)` parse the body from the `IO` stream. - `closeread(::Stream)` reads the trailers and calls `closeread` on the `IO` stream. When the `IO` stream is a [`HTTP.Connections.Connection`](@ref), calling `closeread` releases the connection back to the connection pool for reuse. If a complete response has not been received, `closeread` throws `EOFError`. 638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x638 I.!J49638-9638.Q6.963896389638. I -e 6 .963837?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#cfsizehintbytesbuf638MH A+7?/#96389638,? #self#cf638H+.!J49638.!J49638.!J4p.{. I-.Q679638.!J49638.!J49638.!J49638.X .[.{  I.!M .!J49638.X A!496387++?/#96389638,v/#96389638,w/#96389638,x/#96389638,z/#96389638,{/#96389638,|?"#self#buffind_delimiterbytesl638b V-9638-96386.!J963849638-9638- W7 W3 W ~-9638-9638. F7?/#96389638,a/#96389638,b/#96389638,c/#96389638,e/#96389638,g? #self#io638 V-9638-9638-k6 I3.!J963849638-9638- I.!M  W7 W ~7?/#96389638,Z/#96389638,Z/#96389638,]? #self#io638a.!J49638-96387?/#96389638,-? #self#ws,i5$ a!4HCkP n(EL+}j8.]lmxTD'St71%<MG?z V9\|I:eX=/O~-ZU&*w_yvfR^)Ju2c3F p0Nb[@A oY`g;r{>qQdKWB6s" h#638close ConnectionConnection Timeout: -/opt/julia/packages/HTTP/sJD5V/src/Servers.jl+L-!M6+L-9638.|6+G    I96389638 I  -!M9638.96386+7 I 9638 I # I A9638   .9638O 9638V-9638k6+7 I 49638 A963896389638    6+7 I9638 .9638w96386+"!9638 I-  I+  V+) I.!y9638  I A i I> W3+. W I  A!963896389638     > I= ~#6+7 A!i.!@/-!e061+5 A963896389638     3+6 A 0963896389638     3+79638V V+@ I+.96389638-!:.9638+;.9638< W3+B W I-9638. O6C+F A!3+L A9638.sG.XH-9638I37?+L+L?+!/#96389638,/#96389638, /#96389638, /#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638, /#96389638, /#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?  !i#self#creadtimeoutwait_for_timeoutmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638. L49638. L49638. L49638 A96387?/#96389638,?#self#638!error while handling connection. !handle_connection handler error. closewrite closeread Server never wrote a response. invoking handlerclose Connection#handle_connection startread error. startread called-/opt/julia/packages/HTTP/sJD5V/src/Servers.jl)0o+ . K I->.|69638- - -  A K I R  I -!9638 6=.!96389638 -!9638  V+ Ig+ V+-96386+.!J49638-9638-k6+-96386+ I A9638 I .9638   V+L-9638     I9638 9638 I-!M9638 .9638 *+6,+H I9638 I# I A9638.9638 O9638 V-9638 k162+H I49638 A9638 9638963865+H I9638.9638 w9638 68+<!9638 I-: I+ I 9638 I A i6>+H A!i.!@@ -!eA6B+F A9638 96389638 3+G A A9638 96389638 3+H9638 V A!496389638 W3+ W I .w96386N+[.!J49638.QP496386Q+U Ih+3+V Ih+h.!J49638-yW.9638VX.[Y I 9638 9638 I -!M9638 .9638 ef6g+ I9638 I# I A9638.9638 O9638 V-9638 kl6m+ I49638 A9638 96389638 6p+ I9638.9638 w9638 6s+w!9638 I-u I+ V+ I! A9638 I.!y9638! I A i Ii> W3+ W I"  A!96389638 9638 "> Ii= ~x6i+ A!i.!@-!e6+ A9638 96389638 3+ A 9638 96389638 3+9638 V ~3+ ~ A9638  9638!9638"6+ A!496389638#.!J 49638$.9638!9638".9638%.!J 49638$ A!49638&+ V+} Ij+ V+%#$%&'()* I,9638 9638 I+,+-!M9638 .9638 6+ I*9638 I)# I( A9638+*).9638 O(9638 V-9638 k6+ I'49638' A9638 96389638(,)*'6+ I&9638.9638 w&9638 6+!9638 I&-& I%+ I#9638( I$ A i6>+ A!i.!@$-!e6+ A9638 96389638(,#)*'&%3+ A 9638 96389638(,#)*'&%3+9638 V!9638. -9638 6+-9638) -k6+.!y9638* -I-./01234 I69638 9638 I565-!M9638 .9638 6+ I49638 I3# I2 A9638543.9638 O29638 V-9638 k6+ I149638+ A9638 96389638263416+ I09638.9638 w09638 6+!9638 I0-0 I/+ I-9638, I. A i6>+ A!i.!@.-!e6+ A9638 9638963826-3410/3+ A 9638 9638963826-3410/3+9638 V-9638- 789:;<=> I@9638 9638 I?@?-!M9638 .9638 ))6)+  I>9638 I=# I< A9638?>=.9638 O<9638 V-9638 k) 6) +  I;49638. A9638 96389638<@=>;6) +  I:9638.9638 w:9638 6)+!9638 I:-): I9+ I79638/ I8 A i6>+  A!i.!@)8-!e)6)+ A9638 96389638<@7=>;:93+ A )9638 96389638<@7=>;:93+ 9638 V-96380 A!4963896381 W3+{ WA IB B!96382.w)())6)*+1-9638-k),6)-+1 Ik.!J9638349638 3+2 Ik.!J96383496384 IAkCDEFGHIJK ILA.9638 wL963856)=+A IlL3+C.9638 N96385L Il. )A96385 IKlK-!M9638 .9638 )D)E6)F+o IJ9638 II# IH A9638KJI.9638 OH9638 V-9638 k)K6)L+o IG496386 A9638 96389638HLIJG6)O+o IF9638.9638 wF9638 6)R+V!9638 IF-)TF IE+ V+a IM A9638 IC.!y96387M96388. K i)Z- F ID-)[)\ Im> W3+f W IN  A!96389638 9638HLIJGFEN> Im= ~)W6m+o A!i.!@)gD-!e)h6)i+m A9638 96389638HLCIJGFE3+n A )h9638 96389638HLCIJGFE3+o9638 V-9638 6)p+y-9638) -k)r6)s+y.!J 49638$ A!)u49638&+-96389 -96380 A!496389638# ~ W3+ W Ij.?V6)+ V+OPQRSTUV IX9638 9638: IWXW-!M9638 .9638 ))6)+ IV49638; IU# IT A9638WVU.9638 OT9638 V-9638 k)6)+ IS49638< A9638 96389638TXUVS6)+ IR9638.9638 wR9638 6)+!9638 IR-)R IQ+ V+ IO.9638= IP A i In> W3+ W IY  A!96389638 9638TXUVSRQY> In= ~)6n+ A!i.!@)P-!e)6)+ A9638 96389638TXOUVSRQ3+ A )9638 96389638TXOUVSRQ3+9638 V W3+ W IZ .9638>wZ9638>9638?6)+-9638>Z3+.9638>wZ--9638>)6)+3+-9638>Z ~). Oj6)+ A!3 W3+ W[\]^_`ab Id9638 96384 Icdc-!M9638 .9638 ))6)+ Ib9638 Ia# I` A9638cba.9638 O`9638 V-9638 k)6)+ I_49638@ A9638 96389638`dab_6)+ I^9638.9638 w^9638 6)+!9638 I^-)^ I]+ V+ Ie A9638 I[.!y9638Ae I\ A i Io> W3+ W If  A!96389638 9638`dab_^]f> Io= ~)6o+ A!i.!@)\-!e)6)+ A9638 96389638`d[ab_^]3+ A )9638 96389638`d[ab_^]3+9638 V ~ W3+ W Ig.|6)+=.!x)-9638B. Og6)+  A!7?+ + ?+/#9638C9638D,/#9638C9638D,/#9638C9638D,/#5z,/#5z, /#5z, /#5z, /#5z, /#5z,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,T/#5,U/#5,V/#5,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#5,~,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,,(/#5,s,(/#5,t,(/#59638D,,:/#59638D,,:/#5,u,(/#5,v,(/#5,x,(/#5,y,(/#5,,(/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#5,~,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,,H/#5,T,H/#5,U,H/#5,V,H/#5,,H/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#5,~,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,,`/#5,T,`/#5,U,`/#5,V,`/#5,,`/#9638C9638D,/#9638C9638D,/#5,~,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,,v/#5,T,v/#5,U,v/#5,V,v/#5,,v/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#59638D,,/#59638D,,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#59638E,/#59638E,/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#59638E,,/#59638E,,/#9638C9638D,/#9638C9638D,/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#59638D,,/#59638D,,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#9638C9638D,/#9638C9638D,/#9638C9638D,/#9638C9638D,? !"#######$%%%%%&&''''''''''))))))))*+,,,,-./0001223445569;<=>>>>>?@@@@@@@@@ABBBCCDEEEFFGGGIIIIIIIIJKLLLLMNOPPPQRRSTTUUVYZ[[[[[[[\]]^^^^^__aaaaaaaabcddddefghhhijjkllmmnqrssssssstuwwwwwwwwxyzzzz{|}~~~ǰɮk#self#fclistenerreadtimeoutaccess_logwait_for_timeout#18taskhttprequestmsgkwargslinefileidlogger_modulegroupstd_levellevelemsgkwargslinefileidlogger_modulegroupstd_levellevelmsgerrmsgkwargslinefileidlogger_modulegroupstd_levellevelmsgkwargslinefileidlogger_modulegroupstd_levellevelmsgkwargslinefileidlogger_modulegroupstd_levellevellevelemsgkwargslinefileidlogger_modulegroupstd_levellevelmsgerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerremsgkwargslinefileidlogger_modulegroupstd_levellevelmsgerr638+# V I+. L49638. L49638. L49638. L49638. L49638 I A9638 I W3 W I I. L49638-!c V+ I+. L49638. L49638.9638 W3+ W I-!9638 . O6+ A!!9638 . L49638 -. O6 +# A!7+#+#?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#59638,/#59638, /#59638, /#59638, /#59638, /#9638 9638 ,? #self#temp638 errored.  closing Server on !tcpisvalid: unable to accept new connection , thread id: :Listening on: -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlNH+O!9638 I -. 6+<  I96389638 I-!M9638.96386+: I9638 I# I A9638.9638O9638V-9638k6+: I49638 A9638963896386+: I9638 .9638w96386+!!9638 I- I+~ V+,.!J49638 .!J49638 9638 9638 A% I A!y9638#9638$9638& I A i IJ> W3+1 W I  A!963896389638> IJ= ~"6J+: A!i.!@2-!e364+8 A963896389638 3+9 A 3963896389638 3+:9638V3+<-9638 -96386=+O V+!9638-B I-9638.OV6E+s !" I$96389638 I#$#-!M9638.9638QR6S+o I"9638 I!# I A9638#"!.9638O 9638V-9638kX6Y+o I49638 A963896389638 $!"6\+o I9638 .9638w96386_+c!9638 I-a I+ I9638 I A i6>+o A!i.!@g-!eh6i+m A963896389638 $!"3+n A h963896389638 $!"3+o9638V W3+N3+--ks6t+%&'()*+, I.96389638 I-.--!M9638.96386+ I,9638 I+# I* A9638-,+.9638O*9638V-9638k6+ I)49638 A963896389638*.+,)6+ I(9638 .9638w(96386+!9638 I(-( I'+ V+ I%.!y9638 I& A i IK> W3+ W I/  A!963896389638*.+,)('/> IK= ~6K+ A!i.!@&-!e6+ A963896389638*.%+,)('3+ A 963896389638*.%+,)('3+9638V- W3+N I-9638 A!496389638 I -!c V+ IL+. W3+ W IL-!9638 . OL6+ A!.!J49638 .!J49638 A!49638! A!49638"9638#- - - - - -  -  -  A K I0 R 0 I1-!9638$6=+.!9638%9638&1-!9638'11 W3+N W I2 2!9638(.w6+.!J249638)!9638*.Q6+. 6+3456789: I<96389638 I;<;-!M9638.96386+ I:9638 I9# I8 A9638;:9.9638O89638V-9638k6+ I749638+ A9638963896388<9:76+ I69638 .9638w696386+!9638 I6-6 I5+ V+.!J49638 .!J49638 I3 A!y9638,96389638- I4 A i IM> W3+ W I=  A!9638963896388<9:765=> IM= ~6M+ A!i.!@) 4-!e) 6) + A9638963896388<39:7653+ A ) 9638963896388<39:7653+9638V3+3+M>?@ABCDE IG96389638. IFGF-!M9638.9638))6) +H IE9638 ID# IC A9638FED.9638OC9638V-9638k)%6)&+H IB49638/ A963896389638CGDEB6))+H IA9638 .9638wA96386),+0!9638 IA-).A I@+ V+: IH A96380.!J49638 .!J49638 I> A!y9638,)39638)496381H I? A i IN> W3+? W II  A!963896389638CGDEBA@I> IN= ~)16N+H A!i.!@)@?-!e)A6)B+F A963896389638CG>DEBA@3+G A )A963896389638CG>DEBA@3+H9638V A96382.s)I96383?.X96383?)J-96384)K ~?3+=7?+O+O?+/#9638596386,}/#9638596386,~/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638596386,/#9638596386,/#9638596386,/#9638596386,/#9638596386,/#9638596386,/#9638596386,/#5,~, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,, /#5,T, /#5,U, /#5,V, /#5,, /#9638596386,/#9638596386,/#9638596386,/#5,~,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,,7/#5,s,7/#5,t,7/#5,u,7/#5,v,7/#5,x,7/#5,y,7/#5,,7/#9638596386,/#9638596386,/#9638596386,/#9638596386,/#9638596386,/#596387,,S/#596387, ,S/#596387, ,S/#596387, ,S/#596387, ,S/#9638596386,/#9638596386,/#5z,,Z/#5z, ,Z/#5z, ,Z/#5z, ,Z/#5z, ,Z/#5z,,Z/#9638596386,/#9638596386,/#5,~,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,,b/#5,s,b/#5,t,b/#5,u,b/#5,v,b/#5,x,b/#5,y,b/#5,,b/#9638596386,/#5,~,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,,z/#5,s,z/#5,t,z/#596386,,/#596386,,/#5,u,z/#5,v,z/#5,x,z/#5,y,z/#5,,z/#9638596386,/#9638596386,/#9638596386,? !!!!!!!!"#$$$$%&'((()**+,,--.123333333455666888888889:;;;;<=>???@AABCCDDEHIJKKKKKLMMMMMMMMMNOPPQRTUVVWWWWWXXXXYYYY\\\\\\\\\\\\\\]^_`ZZZZaaaaaaaabbccccccccdeffffghijjjkllmnnoopstttuvvvvvwxxxxxxxxxy{{{{{{{{|}~~~~#self#flistenerconnstcpisvalidmax_connectionsreadtimeoutaccess_logready_to_acceptconns_lockverbosesemmsgkwargslinefileidlogger_modulegroupstd_levellevelerrtempconniomsgkwargslinefileidlogger_modulegroupstd_levellevelmsgkwargslinefileidlogger_modulegroupstd_levellevelerr#16taskemsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelmsgerr6381. L49638. L49638. L49638. L49638. L49638. L49638. L49638. L49638. L49638. L49638 A9638   7 ?/#9638 9638 ,W?#self#638++9638. L49638- . L49638- . L49638- . L49638- . L49638-  . L49638-  . L49638- . L49638- . L49638 - . L49638 -  A K   . L49638. L49638. L49638. L49638. L49638. L49638. L49638. L49638. L49638 . L49638 I R 9638 . K i#. L49638- F%-$&.!J9638 49638 .!J963849638 A '(")7*++++?/#96389638,W? #self##116381. L49638. L49638. L49638. L49638. L49638. L49638. L49638. L49638. L49638. L49638 A9638   7 ?/#9638 9638 ,k?#self#638+=? . K96389638 I A I A963896389638 I A.|6+#9638- - - - - -  -  -  - -  A K      I R   I-96389638= A!49638.9638963849638 6=+ .96389638 9638 -96389638  I 3+;9638 - - - - - -  -  -  - -  A K#$%&'()*+,-  I R.  /0 I-963896382= A!496384.9638963849638 6=+9.96389638 9638 -96389638  I -9638 A9638  7<+=+=?+/#96389638,f/#96389638,g/#96389638,h/#96389638,i/#96389638,j/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#96389638,n/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#96389638,q/#96389638,r? #listen!#9on_shutdowntcpisvalidmax_connectionsreadtimeoutaccess_logverbosekwflistenertskready_to_acceptconns_lockconns#10task#12task638|9638 A i-! A F A }!P7?/#96389638,F?#self#fargs638V9638-V A i-! A9638=7?/#96389638,_?#self#flistener638? 49638 449638 A 496384W9638-7?/#96389638,W? #self#__source____module__ex638+? A!i.!@-!e6 I.96383 I A 9638 I V I+-9638 W3 W I-. O6+ A!7++?/#96389638,I/#96389638,K/#96389638,L/#96389638,O/#96389638,Q?"#listen#8kwflistenerserver638|9638 A i-! A F A }!P7?/#96389638,E?#self#fargs638h A i-! A96387?/#96389638,H?#self#flistener638? A!i.!@-!e6 I A }!P96383. F9638 I A }!P  A!i.!@ -!e 6 .9638 7 A  9638 7?/#96389638,F?#listen!#7kwfargs638? A!i.!@-!e6 I A }!P96383. F9638 I A }!P  A!i.!@ -!e 6 .9638 7 A  9638 7?/#96389638,E?#listen#6kwfargs638;7V?/#96389638,?#self##unused#638 failed. shutdown function -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlTH+: V A W7 W  I 96389638 I   -!M9638.96386+8 I 49638 I # I A9638   .9638O9638V-9638k6+8 I49638 A963896389638   6+8 I9638.9638w96386+"!9638 I-  I+ V+* I A9638 I A!y9638 9638  I A i I> W3+/ W I  A!963896389638    > I= ~#6+8 A!i.!@0-!e162+6 A963896389638   3+7 A 1963896389638   3+89638V ~78+:+:?+/#96389638,/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#59638,,/#59638,,/#5,u/#5,v/#5,x/#5,y/#5,? P#self#fnmsgkwargslinefileidlogger_modulegroupstd_levellevelmsgerr638Y.963896387?/#96389638,? #self#fns638 A!496389638-7??/#96389638,/#96389638,/#96389638,? #self#c638+.!J49638.Q96386 A!496389638-3 A!4963896387??/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? #self#c638n.Q963867.Q96387?/#96389638,? #self#st638+!.!J49638-9638.!J49638- I.!J49638-!c V+ I+.!J49638 I-!P . O?-!Z 6 + I. L. L- I.!P . O?-!Z6+3 W3+ W I-!9638. O6+ A!.!J49638-96387 +!+!?/#96389638 ,/#96389638 ,/#96389638 ,/#59638 ,/#59638 , /#59638 , /#59638 , /#59638 ,/#59638 ,/#59638 ,/#59638 , /#96389638 ,?  #self#stempc@ (08638.!J49638.!J49638.!J49638-7?/#96389638,~? #self#s-/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻ;Start a `check_readtimeout` task to close the `Connection` if it is inactive. Passes the `Connection` object to handle a single request/response transaction for each HTTP Request received. After `reuse_limit + 1` transactions, signal `final_transaction` to the transaction handler, which will close the connection. -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻmThe `HTTP.Servers` module provides core HTTP server functionality. The main entry point is `HTTP.listen(f, host, port; kw...)` which takes a `f(::HTTP.Stream)::Nothing` function argument, a `host`, a `port` and optional keyword arguments. For full details, see `?HTTP.listen`. For server functionality operating on full requests, see the `?HTTP.serve` function. -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻ HTTP.listen(handler, host=Sockets.localhost, port=8081; kw...) HTTP.listen(handler, port::Integer=8081; kw...) HTTP.listen(handler, server::Base.IOServer; kw...) HTTP.listen!(args...; kw...) -> HTTP.Server Listen for HTTP connections and execute the `handler` function for each request. Listening details can be passed as `host`/`port` pair, a single `port` (`host` will default to `localhost`), or an already listening `server` object, as returned from `Sockets.listen`. To open up a server to external requests, the `host` argument is typically `"0.0.0.0"`. The `HTTP.listen!` form is non-blocking and returns an `HTTP.Server` object which can be `wait(server)`ed on manually, or `close(server)`ed to gracefully shut down the server. Calling `HTTP.forceclose(server)` will immediately force close the server and all active connections. `HTTP.listen` will block on the server listening loop until interrupted or and an irrecoverable error occurs. The `handler` function should be of the form `f(::HTTP.Stream)::Nothing`, and should at the minimum set a status via `setstatus()` and call `startwrite()` either explicitly or implicitly by writing out a response via `write()`. Failure to do this will result in an HTTP 500 error being transmitted to the client. Optional keyword arguments: - `sslconfig=nothing`, Provide an `MbedTLS.SSLConfig` object to handle ssl connections. Pass `sslconfig=MbedTLS.SSLConfig(false)` to disable ssl verification (useful for testing). Construct a custom `SSLConfig` object with `MbedTLS.SSLConfig(certfile, keyfile)`. - `tcpisvalid = tcp->true`, function `f(::TCPSocket)::Bool` to check if accepted connections are valid before processing requests. e.g. to do source IP filtering. - `readtimeout::Int=0`, close the connection if no data is received for this many seconds. Use readtimeout = 0 to disable. - `reuseaddr::Bool=false`, allow multiple servers to listen on the same port. Not supported on some OS platforms. Can check `HTTP.Servers.supportsreuseaddr()`. - `server::Base.IOServer=nothing`, provide an `IOServer` object to listen on; allows manually closing or configuring the server socket. - `verbose::Bool=false`, log connection information to `stdout`. - `access_log::Function`, function for formatting access log messages. The function should accept two arguments, `io::IO` to which the messages should be written, and `http::HTTP.Stream` which can be used to query information from. See also [`@logfmt_str`](@ref). - `on_shutdown::Union{Function, Vector{<:Function}, Nothing}=nothing`, one or more functions to be run if the server is closed (for example by an `InterruptException`). Note, shutdown function(s) will not run if an `IOServer` object is supplied to the `server` keyword argument and closed by `close(server)`. e.g. ```julia # start a blocking server HTTP.listen("127.0.0.1", 8081) do http HTTP.setheader(http, "Content-Type" => "text/html") write(http, "target uri: $(http.message.target)
") write(http, "request body:
")
    write(http, read(http))
    write(http, "
") return end # non-blocking server server = HTTP.listen!("127.0.0.1", 8081) do http @show http.message @show HTTP.header(http, "Content-Type") while !eof(http) println("body data: ", String(readavailable(http))) end HTTP.setstatus(http, 404) HTTP.setheader(http, "Foo-Header" => "bar") startwrite(http) write(http, "response body") write(http, "more response body") end # can gracefully close server manually close(server) ``` To run the following HTTP chat example, open two Julia REPL windows and paste the example code into both of them. Then in one window run `chat_server()` and in the other run `chat_client()`, then type `hello` and press return. Whatever you type on the client will be displayed on the server and vis-versa. ``` using HTTP function chat(io::HTTP.Stream) Threads.@spawn while !eof(io) write(stdout, readavailable(io), "\n") end while isopen(io) write(io, readline(stdin)) end end chat_server() = HTTP.listen("127.0.0.1", 8087) do io write(io, "HTTP.jl Chat Server. Welcome!") chat(io) end chat_client() = HTTP.open("POST", "http://127.0.0.1:8087") do io chat(io) end ``` -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻX" Main server loop. Accepts new tcp connections and spawns async tasks to handle them." -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻm HTTP.Server Returned from `HTTP.listen!`/`HTTP.serve!` once a server is up listening and ready to accept connections. Internally keeps track of active connections. Also holds reference to any `on_shutdown` functions to be called when the server is closed. Also holds a reference to the listening loop `Task` that can be waited on via `wait(server)`, which provides similar functionality to `HTTP.listen`/ `HTTP.serve`. Can initiate a graceful shutdown where active connections are allowed to finish being handled by calling `close(server)`. For a more forceful and immediate shutdown, use `HTTP.forceclose(server)`. -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻ, ConnectionState When a connection is first made, it immediately goes into IDLE state. Once startread(stream) returns, it's marked as ACTIVE. Once closewrite(stream) returns, it's put back in IDLE, unless it's been given the CLOSING state, then it will close(c) itself and mark itself as CLOSED. -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻFIf `c` is inactive for a more than `readtimeout` then close the `c`." -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻ shutdown(fns::Vector{<:Function}) shutdown(fn::Function) shutdown(::Nothing) Runs function(s) in `on_shutdown` field of `Server` when `Server` is closed. -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlڻ HTTP.listen!(args...; kw...) -> HTTP.Server Non-blocking version of [`HTTP.listen`](@ref); see that function for details. 638+5 V96389638 I A96389638.96389638.96389638-  W7 W I  V+- W3+# W I .9638w963896386+-96383+!9638.9638w-96386+!3+"-9638 ~!9638.w#$6%++V ~7'3++96389638.w+,6-+3V ~7/3+3- ~73+5+5?/#9638 9638 ,U/#9638 9638 ,V/#9638 9638 ,W/#9638 9638 ,X/#9638 9638 ,Y/#9638 9638 ,Z/#9638 9638 ,\/#59638 /#59638 /#59638 ,/#59638 ,/#9638 9638 ,]/#9638 9638 ,^/#9638 9638 ,_? #self#tcpsslconfigsslee63896389638.!J49638-.!J49638.96387?/#96389638,R? #self#s63896389638.!J49638-. 96387?/#96389638,Q? #self#s638? A!i.!@-!e696389638.9638+7963896389638 A   +7 ?/#96389638,L?#Listener#5kw638? A!i.!@-!e696389638.96387963896389638 A   7 ?/#96389638,K?#Listener#4kwport638?.9638-y-y A!i.!@-!e6 A96387 A 96387 ?/#96389638,J?#Listener#3kwhostport6387reuseaddr=true failed; falling back to regular listen: /reuseaddr=true not supported on this platform: -/opt/julia/packages/HTTP/sJD5V/src/Servers.jlx)+? I% I' I&   .?%V69638. K i - F-  A  9638%76+96389638.!J&49638.!J&49638..!l I. L I . L A!l I%. L.!J&49638 I&.9638 I'-y3+6+ A9638-k6 +V I96389638 I-!M9638 .9638,-6.+T I49638 I# I A9638 .9638O9638V-9638k364+T I49638 A96389638963867+T I9638.9638w96386:+>!9638 I-< I+7 V+F.!J963849638 I.!y9638@ I A i I(> W3+K W I  A!963896389638> I(= ~?6(+T A!i.!@L-!eM6N+R A9638963896383+S A M9638963896383+T9638V3+9638. K iV- F=-WX96389638 I%. YZ. Ko).!J%49638.!`\]. Ko).!Y_^ I S49638$49638`^._ 6b+-% ! I#96389638 I"#"-!M9638 .9638op6q+ I!49638 I # I A9638 "! .9638O9638V-9638kv6w+ I49638 A963896389638# !6z+ I9638.9638w96386}+!9638 I- I+> V+.!J963849638 I.!y9638 I A i I)> W3+ W I$  A!963896389638# !$> I)= ~6)+ A!i.!@-!e6+ A963896389638# !3+ A 963896389638# !3+9638V3+9638. K i- F>-96389638%.!J&49638.!J&49638 A 9638 . K i- F-96389638! A %3+9638 . K i- F-96389638! I% A & A9638& '%7++?+C/#9638"9638#,./#9638"9638#,//#9638"9638#,1/#9638"9638#,2/#9638"9638#,3/#9638"9638#,4/#9638"9638#,5/#9638"9638#,6/#9638"9638#,7/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638"9638#,8/#9638"9638#,:/#9638"9638#,;/#9638"9638#,</#9638"9638#,=/#9638"9638#,>/#5,~,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,s,&/#5,t,&/#5,u,&/#5,v,&/#5,x,&/#5,y,&/#5,,&/#9638"9638#,?/#9638"9638#,A/#9638"9638#,B/#9638"9638#,D/#9638"9638#,E/#9638"9638#,G?  !""""""######$$%''''''''()****+,-.../001223347889:::::;<<<<<<<<<=>?????????@@@@@@BBBBBBCC#Listener#2sslconfigreuseaddrbacklogserverlistenanykwaddrhostportrcpmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrserveraddrport638c S49638$;49638.Q7?/#96389638,%?#self#638  ?-9638.!l I . L I. L A!l I. L I.9638 -y -y A9638   7 ?/#96389638, /#96389638,!/#96389638,"?1#Listener#1sslconfigkwserveraddrporthost638e.!J963849638.7?/#96389638,?#self#hostport638w.!J963849638.9638.7?/#96389638?#self#hostport63887>?/#96389638? #self#x638R?-96387?/#96389638, ?#self#__source____module__s638, H+#.!J963849638 I A._6-^ I .f  3 I = 63 A9638? I.9638?6+?.!M I I?3+# I A? A!x I?7+#+#?/#96389638/#96389638/#96389638/#96389638/#96389638/#96389638/#96389638,?#self#fvvalvalvalxtid638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x 0}7m/D`b{B5;'n+j~_Ueg|:IZ2yL 4v"1RuNҾEfY!$^FCqt.\@ > S3kWX<]rha?x(V* #%[di-8GQ,9M=OAsKwpTJ)6o&Pl cHz638Read message: : payload len = : Received frame: `!(ws.readclosed)`: Reading message0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl2C+<      I96389638 I-!M9638.96386+7 I9638 I # I A9638 .9638O 9638V-9638k6+7 I 49638 A963896389638   6+7 I 9638.9638w 96386+!!9638 I - I + V+).!J49638 I.!y#9638 I A i I>> W3+. W I  A!963896389638      > I>= ~"6>+7 A!i.!@/-!e061+5 A963896389638      3+6 A 0963896389638      3+79638V.!J49638-k8-9638k96:+D 06<+@ I?-963896383+A I?9638V?.963896389638A-9638UB.!J496389638.!J49638 I A9638DEF I96389638 I-!M9638.9638RS6T+z I9638 I# I A9638.9638O9638V-9638kY6Z+z I49638 A9638963896386]+z I9638.9638w96386`+d!9638 I-b I+ V+l.!J49638 I A!yf9638 I A i I@> W3+q W I  A!963896389638 > I@= ~e6@+z A!i.!@r-!es6t+x A963896389638 3+y A s963896389638 3+z9638V I.96386+.!J496387}3+.!J49638 I.!J49638-96386+-963873+ I.!J496386>+.!J496389638.!J49638 I A9638 !"#$ I&96389638 I%&%-!M9638.96386+ I$9638 I## I" A9638%$#.9638O"9638V-9638k6+ I!49638 A963896389638"&#$!6+ I 9638.9638w 96386+!9638 I - I+ V+.!J49638 I A!y9638 I A i IA> W3+ W I'  A!963896389638 "&#$! '> IA= ~6A+ A!i.!@-!e6+ A963896389638 "&#$! 3+ A 963896389638 "&#$! 3+9638V I.9638.!J49638.!J49638-9638-k6+.!J49638 I.9638 ()*+,-./ I196389638 I010-!M9638.96386+ I/9638 I.# I- A96380/..9638O-9638V-9638k6+ I,49638! A963896389638-1./,6+ I+9638.9638w+96386+!9638 I+-+ I*+ V+.!J49638 -^ I( A!y9638" I) A i IB> W3+ W I2  A!963896389638 -1./,+*2> IB= ~6B+ A!i.!@)-!e6+ A963896389638 -1(./,+*3+ A 963896389638 -1(./,+*3+9638V6+3+3+3+.w6)+-9638#3+3456789: I<96389638 I;<;-!M9638.9638))6)+; I:9638 I9# I8 A9638;:9.9638O89638V-9638k)6)+; I749638$ A9638963896388<9:76)+; I69638.9638w696386)+!!9638 I6-)6 I5+ V+--.D+)$.{)%.!M)#)& I3.!y9638%)' I4 A i IC> W3+2 W I=  A!963896389638 8<9:765=> IC= ~)"6C+; A!i.!@)34-!e)46)5+9 A963896389638 8<39:7653+: A )4963896389638 8<39:7653+;9638V7+<+<?+/#96389638&,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638&,/#59638',,/#96389638&,/#96389638&,/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#96389638&,/#96389638&,/#96389638&,/#96389638&,/#96389638&,/#96389638&,/#96389638&,/#96389638&,/#5,~,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,,;/#5,s,;/#5,t,;/#5,u,;/#5,v,;/#5,x,;/#5,y,;/#5,,;/#96389638&,/#96389638&,/#96389638&,/#96389638&,/#5,~,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,,V/#5,s,V/#5,t,V/#5,u,V/#5,v,V/#5,x,V/#5,y,V/#5,,V/#96389638&,/#96389638&,/#96389638&,/#96389638&,/#5,~,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,,q/#5,s,q/#5,t,q/#5,u,q/#5,v,q/#5,x,q/#5,y,q/#5,,q/#96389638&,?  !"#$$$%&&'(())*-../0000012222222223455566777789::::<<<<<<<<=>????@ABCCCDEEFGGHHILMMNOOOOOPQQQQQQQQQRSTTTTTUUUWWWWWWWWXYZZZZ[\]^^^_``abbccdghhhijjjjjklllllllllmnnoppprrrrrrrrstuuuuvwxyyyz{{|}}~~o#self#wspayloadopcodedoneframemsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrX   (08@HPQ 638G.y7?/#96389638,? #self#xy638Q.96387?/#96389638,? #self#xy638Fragmented control frame"Reserved bits set in control frameO+E.!J49638.!J4963863.!J49638.!J4963863.!J49638.!J 496386 .9638+9638-9638 -U.!J49638 I.!J49638-96386+.!J49638.!J49638 -k6+.9638+9638 -9638-U.Q9638 6+'> A!49638 .!J49638 -k6 +#-.!J49638-9638#-U$3+C.Q96386'+0.!J49638.!J)49638-9638*.!J49638.9638,7=3+C.Q963860+7.!J49638.!J249638-963837=3+C.!J49638.!J749638 68+C.!J49638.!J:49638.Q;96386<+C.!J49638.w>6?+C.!J49638-9638A.!J49638.!JC49638 7D+E+E?/#96389638,u/#96389638,v/#96389638,x/#96389638,y/#96389638,z/#96389638,|/#96389638,}/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? #self#wsframeopcode(@ 638 Invalid UTF-8 ?-963867.9638+9638-9638-U7?/#96389638,r? #self#x638 Invalid length for control frame ?.|+}6.9638+9638-9638-U77=?/#96389638,q? #self#len6386>. L49638 A!49638. L49638.!J49638-k6. L49638.!J49638-9638 6 . L49638.!J 49638- 77=7=?/#96389638,X/#96389638,Y? #self#t638NH-!M.7?/#96389638,:? #self#ws638: sending pong0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl`!(ws.writeclosed)`?+F.!J49638-k-9638k6 06 I-963896383 I9638V.963896389638 -9638U    I 96389638 I   -!M9638.96386+? I 9638 I # I A9638    .9638O 9638V-9638k6+? I49638 A96389638 9638     6"+? I9638 .9638w96386%+)!9638 I-' I+; V+1.!J49638 I.!y+9638 I A i I> W3+6 W I  A!9638 96389638    > I= ~*6+? A!i.!@7-!e869+= A96389638 9638    3+> A 896389638 9638    3+?9638V.!J496389638.!J49638.9638 A9638>ABC.9638@D7E+F+F?+/#96389638,:/#59638,/#96389638,;/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,<? R#self#wsdatamsgkwargslinefileidlogger_modulegroupstd_levellevelerr638NH-!M.7?/#96389638,+? #self#ws638: sending ping0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl`!(ws.writeclosed)`?+F.!J49638-k-9638k6 06 I-963896383 I9638V.963896389638 -9638U    I 96389638 I   -!M9638.96386+? I 9638 I # I A9638    .9638O 9638V-9638k6+? I49638 A96389638 9638     6"+? I9638 .9638w96386%+)!9638 I-' I+, V+1.!J49638 I.!y+9638 I A i I> W3+6 W I  A!9638 96389638    > I= ~*6+? A!i.!@7-!e869+= A96389638 9638    3+> A 896389638 9638    3+?9638V.!J496389638.!J49638.9638 A9638>ABC.9638@D7E+F+F?+/#96389638,+/#59638,/#96389638,,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,-? R#self#wsdatamsgkwargslinefileidlogger_modulegroupstd_levellevelerr638+.!J496386-96386 I3-y I-9638 I I-^.!J49638.i .!J49638.P.!J496387-96386+7-y-96387++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#wsxlenpload638l-963867963879638?/#96389638,? #self#x638O.w96387?/#96389638,? #self#x638Y. K9638.w7?/#96389638,? #self#x638!Unexpected server websocket error%: Unexpected websocket server error. ,: WebSocket upgraded; connection establishedSec-WebSocket-Accept Connection websocketUpgrade%Expected "Sec-WebSocket-Key header"! Sec-WebSocket-Key&Expected "Sec-WebSocket-Version: 13"! 13Sec-WebSocket-Version"Server websocket upgrade requested0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl-7H+?    I96389638 I-!M9638.96386+/ I9638 I# I A9638.9638O9638V-9638k6+/ I49638 A9638963896386+/ I9638.9638w96386+#!9638 I-! I+ I9638 I A i6>+/ A!i.!@'-!e(6)+- A963896389638 3+. A (963896389638 3+/9638V.!J 49638 -9638 061+43+5 A9638 A9638 96389638-k566+=.!J 49638 -!y8.s96389-9638:-U;.9638 9638-k=6>+E.!J 49638 -!y@.s9638A-9638B-UC.9638 +e.96389638.9638 F.96389638.9638 H I.9638 9638-9638.9638K.9638 L-9638 I.!J 49638 I .!J 49638 I -9638 .!J 49638!!9638"!9638#. FST.9638$RU6V+`-9638% 6X+`.!J9638&49638' .Z[.!J9638&49638( .]^9638). K i` A F=-ab9638* .!J 49638+ I A cdefg ! I#96389638 I"#"-!M9638.9638st6u+ I!9638 I # I A9638"! .9638O9638V-9638kz6{+ I49638, A963896389638# !6~+ I9638.9638w96386+!9638 I- I+ V+.!J 49638- I.!y9638. I A i I2> W3+ W I$  A!963896389638/# !$> I2= ~62+ A!i.!@-!e6+ A963896389638 # !3+ A 963896389638 # !3+9638V V+ I3+ V+ I4-  W3+ W I% -96380%-k6+6+3+&'()*+,- I/963896381 I./.-!M9638.96386+ I-496382 I,# I+ A9638.-,.9638O+9638V-9638k6+ I*496383 A963896389638+/,-*6+ I)9638.9638w)96386+!9638 I)-) I(+ V+ I0 A96384.!J 49638- I& A!y963850 I' A i I5> W3+ W I1  A!963896389638/+/,-*)(1> I5= ~65+ A!i.!@'-!e6+ A963896389638 +/&,-*)(3+ A 963896389638 +/&,-*)(3+9638V-96386 -k6+.w%96386+.!J%49638 .w963876+ .!J%49638 .3+ .96387+96388.-96380%-k6+ I6 A3+ I6? I46 ~ I74 I3 W3+ W I3-96386 -k6+ .96387+G.. O36)+ A!77++?+e/#963899638:,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,T/#5,U/#5,V/#5,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#5,~,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,,)/#5,s,)/#5,t,)/#5,u,)/#5,v,)/#5,x,)/#5,y,)/#5,,)/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#5,~,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,,D/#5,s,D/#5,t,D/#59638:,,V/#59638:,,V/#5,u,D/#5,v,D/#5,x,D/#5,y,D/#5,,D/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,/#963899638:,?  !"$%%%%%%%%&&&'''(((((((((********+,----./0111233455667:;;<=====>?????????@AAABBBBBCCCDDEEEEEEEEFGHHHHIJKLLLMNNOPPQQRUWXXYZZZZZ[\\\\\\\\\]^^^_____```aaabbbccccccccccdddeeeeee7#upgrade#14suppress_close_errormaxframesizemaxfragmentationnaglequickackkwfhttpwssockreqiokeymsgkwargslinefileidlogger_modulegroupstd_levellevelmsgkwargslinefileidlogger_modulegroupstd_levellevelerremsgkwargslinefileidlogger_modulegroupstd_levellevelmsgerr638-9638 A i-! A9638==>7?/#96389638,?#self#fhttp638 A!i. L49638.!@-!e6. L49638.963879638. L49638 A   7 ?/#96389638,? #self#http638&?9638- -  A K I R A!i.!@-!e 6 .!J963849638- F A }!P  7.!J963849638 A F  A }!P 7?/#96389638,?#listen!#11kwfargs#12638|9638 A i-! A F A }!P7?/#96389638,?#self#fargs638 A!i. L49638.!@-!e6. L49638.963879638. L49638 A   7 ?/#96389638,? #self#http638&?9638- -  A K I R A!i.!@-!e 6 .!J963849638- F A }!P  7.!J963849638 A F  A }!P 7?/#96389638,?#listen#8kwfargs#9638|9638 A i-! A F A }!P7?/#96389638,?#self#fargs638!Unexpected client websocket error: error: WebSocket opened0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlInvalid Sec-WebSocket-Accept Sec-WebSocket-Accept!+-9638.!J49638-963863 A9638.96389638. L49638-9638 .v  6 .!J49638-!y.s9638-9638 -U A!49638 I.!J49638 .!J49638.!J49638 9638 . K i. L49638. L49638. F-9638.!J49638 I A     I96389638 I  -!M9638.9638+,6-+S I 9638 I # I A9638   .9638O 9638V-9638k263+S I 49638 A963896389638    66+S I9638.9638w963869+=!9638 I-; I+x V+E.!J49638 I.!y?9638 I A i I> W3+J W I  A!963896389638    > I= ~>6+S A!i.!@K-!eL6M+Q A963896389638    3+R A L963896389638    3+S9638V V+ I+ V+[. L49638 I-W W3+ W I -9638 -k]6^+. L49638!6`+d. L49638!3+ I96389638" I-!M9638.9638no6p+ I49638# I# I A9638.9638O9638V-9638ku6v+ I49638$ A9638963896386y+ I9638.9638w96386|+!9638 I-~ I+} V+.!J49638 I.!y9638%9638&. K i A9638'. F- F I- I> W3+ W I  A!963896389638> I= ~6+ A!i.!@-!e6+ A9638963896383+ A 9638963896383+9638V-9638(-k6+.w9638 6+.!J49638.w9638)6+.!J49638.3+.9638)+9638*.-9638 -k6+ I A3+ I ? I ~V I! I W3+ W I-9638(-k6+.9638)+G.. O6+ A!7!++?+B/#9638+9638,,l/#9638+9638,,m/#9638+9638,,n/#9638+9638,,o/#9638+9638,,u/#9638+9638,,v/#9638+9638,,w/#9638+9638,,x/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638+9638,,y/#9638+9638,,z/#9638+9638,,|/#9638+9638,,}/#5,~,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,,#/#5,s,#/#5,t,#/#5,u,#/#5,v,#/#5,x,#/#5,y,#/#5,,#/#9638+9638,,/#9638+9638,,/#9638+9638,,/#9638+9638,,/#9638+9638,,/#9638+9638,,/#9638+9638,,/#9638+9638,,?  !!!!!!"""###$$$$$$$$%&''''()*+++,--.//0014556666666777778999999999:;;;<<<<<===>>>???@@@@@@@@@@AAABBBBBB#self#httpwsiomsgkwargslinefileidlogger_modulegroupstd_levellevelerremsgkwargslinefileidlogger_modulegroupstd_levellevelerr638GET13Sec-WebSocket-VersionSec-WebSocket-Key Connection websocketUpgradeG H+? I .!J963849638 A A9638 I -9638.96389638.96389638.9638 .96389638 A F   I A }!P!  9638 - - - -  -  A K I R   9638 . K i- F-.!@ A 9638 9638   7++?/#96389638,b/#96389638,c/#96389638,k?d#open#5suppress_close_errorverboseheadersmaxframesizemaxfragmentationkwfurl#6keyheaders638p A i-! A96387?/#96389638,C?#self#fmethodurlheaders638bH-!M9638 A7?/#96389638,C?#self#fmethodurl638 A!-9638 A i-! A9638==7?/#96389638,a? #self#furl638$258EAFA5-E914-47DA-95CA-C5AB0DC85B11-9638 I.!y9638.96389638-96387?/#96389638,I/#96389638,J?#self#keyhashkey638Websocket handshake failedr ?.9638+9638-9638-U7?/#96389638,F?#self#6384`is_upgrade` is deprecated, use `isupgrade` instead.\ ?? 9638-9638.!J49638.!J49638.!J49638.!96389638 A!i.!@ -!e 6 A }!P96387 . F 9638 A }!P 7?/#96389638,r/#96389638,s/#96389638,t?#is_upgrade#4kwargsargs638y ?9638 A i-!. F A }!P7?/#96389638,q? #self#args638 websocketUpgradekeep-alive, upgradeupgrade ConnectionGET+.w96386.!J49638 I.Q96383 I=63.w96386 .!J49638 I.Q +e3 I=6+ A96389638963863+ A9638963896386+ A96389638 9638 77=7=++?/#9638 9638 ,<? #self#r638o.!J496386.!J4963877=?/#96389638,7? #self#ws638? A9638-!M-!M A9638==7?/#96389638,/??#WebSocket#3clientmaxframesizemaxfragmentationioreqresp638B+.w96386+.!J49638.w96386.!J49638.!J49638.Q+67.!J49638.!J 49638.Q +6 7 .!J49638.!J49638.Q+77=7=++?/#96389638,? #self#x638Invalid close status code ?.f+6 I._+3 I=6 A F+++++L++ .7 I-k 3 I=6 7 .9638+9638-9638-U7?/#96389638,? #self#x@ (08ReservedPolicy ViolationInternal ErrorUnsupported DataAbnormal Closure- reservedInvalid frame payload dataTry Again LaterNormalMessage too bigMissing ExtensionService Restart Going AwayNo Status Recvd- reservedProtocol Error Bad Gateway TLS Handshakese(405)` (method not all%bp%bp%bpppp%bp%bp%bp%bpܜ˔638+2.!J49638.!J49638-9638-9638 I.[.!J49638.?V6.!J49638.!J49638-9638 .[  I.X .!J49638.v96386+.!J49638.!J49638-<.[ I.X I.!J49638. K.w6+#.!J49638.[ I.X 3+2!9638 A K$%.w#&6'+..!J49638.[* I.X)+3+2.!J49638.[/ I.X.07+2+2?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,? #self#ioxpln0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl#ڻ ping(ws, data=[]) Send a PING control frame on a websocket connection. `data` is an optional body to send with the message. PONG messages are automatically responded to when a PING message is received by a websocket connection. 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻc send(ws::WebSocket, msg) Send a message on a websocket connection. If `msg` is an `AbstractString`, a TEXT websocket message will be sent; if `msg` is an `AbstractVector{UInt8}`, a BINARY websocket message will be sent. Otherwise, `msg` should be an iterable of either `AbstractString` or `AbstractVector{UInt8}`, and a fragmented message will be sent, one frame for each iterated element. Control frames can be sent by calling `ping(ws[, data])`, `pong(ws[, data])`, or `close(ws[, body::WebSockets.CloseFrameBody])`. Calling `close` will initiate the close sequence and close the underlying connection. 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻ(Status codes according to RFC 6455 7.4.10/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻ iterate(ws) Continuously call `receive(ws)` on a `WebSocket` connection, with each iteration yielding a message until the connection is closed. E.g. ```julia for msg in ws # do something with msg end ``` 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻZ WebSocket(io::HTTP.Connection, req, resp; client=true) Representation of a websocket connection. Use `WebSockets.open` to open a websocket connection, passing a handler function `f(ws)` to send and receive messages. Use `WebSockets.listen` to listen for incoming websocket connections, passing a handler function `f(ws)` to send and receive messages. Call `send(ws, msg)` to send a message; if `msg` is an `AbstractString`, a TEXT websocket message will be sent; if `msg` is an `AbstractVector{UInt8}`, a BINARY websocket message will be sent. Otherwise, `msg` should be an iterable of either `AbstractString` or `AbstractVector{UInt8}`, and a fragmented message will be sent, one frame for each iterated element. Control frames can be sent by calling `ping(ws[, data])`, `pong(ws[, data])`, or `close(ws[, body::WebSockets.CloseFrameBody])`. Calling `close` will initiate the close sequence and close the underlying connection. To receive messages, call `receive(ws)`, which will block until a non-control, full message is received. PING messages will automatically be responded to when received. CLOSE messages will also be acknowledged and then a `WebSocketError` will be thrown with the `WebSockets.CloseFrameBody` payload, which may include a non-error CLOSE frame status code. `WebSockets.isok(err)` can be called to check if the CLOSE was normal or unexpected. Fragmented messages will be received until the final frame is received and the full concatenated payload can be returned. `receive(ws)` returns a `Vector{UInt8}` for BINARY messages, and a `String` for TEXT messages. For convenience, `WebSocket`s support the iteration protocol, where each iteration will `receive` a non-control message, with iteration terminating when the connection is closed. E.g.: ```julia WebSockets.open(url) do ws for msg in ws # do cool stuff with msg end end ``` 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻ WebSockets.readframe(ws) -> WebSockets.Frame WebSockets.readframe(io, Frame, buffer, first_fragment_opcode) -> WebSockets.Frame Read a single websocket frame from a `WebSocket` or `IO` stream. Frame may be a control frame with `PING`, `PONG`, or `CLOSE` opcode. Frame may also be part of fragmented message, with opcdoe `CONTINUATION`; `first_fragment_opcode` should be passed from the 1st frame of a fragmented message to ensure each subsequent frame payload is converted correctly (String or Vector{UInt8}). 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻ receive(ws::WebSocket) -> Union{String, Vector{UInt8}} Receive a message from a websocket connection. Returns a `String` if the message was TEXT, or a `Vector{UInt8}` if the message was BINARY. If control frames (ping or pong) are received, they are handled automatically and a non-control message is waited for. If a CLOSE message is received, it is responded to and a `WebSocketError` is thrown with the `WebSockets.CloseFrameBody` as the error value. This error can be checked with `WebSockets.isok(err)` to see if the closing was "normal" or if an actual error occurred. For fragmented messages, the incoming frames will continue to be read until the final fragment is received. The bodies of each fragment are concatenated into the final message returned by `receive`. Note that `WebSocket` objects can be iterated, where each iteration yields a message until the connection is closed. 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻ WebSockets.isok(x::WebSocketError) -> Bool Returns true if the `WebSocketError` has a non-error status code. When calling `receive(websocket)`, if a CLOSE frame is received, the CLOSE frame body is parsed and thrown inside the `WebSocketError`, but if the CLOSE frame has a non-error status code, it's safe to ignore the error and return from the `WebSockets.open` or `WebSockets.listen` calls without throwing. 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl?ڻ close(ws, body::WebSockets.CloseFrameBody=nothing) Initiate a close sequence on a websocket connection. `body` is an optional `WebSockets.CloseFrameBody` with a status code and optional reason message. If a CLOSE frame has already been received, then a responding CLOSE frame is sent and the connection is closed. If a CLOSE frame hasn't already been received, the CLOSE frame is sent and `receive` is attempted to receive the responding CLOSE frame.  0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻ WebSockets.listen(handler, host, port; verbose=false, kw...) WebSockets.listen!(handler, host, port; verbose=false, kw...) -> HTTP.Server Listen for websocket connections on `host` and `port`, and call `handler(ws)`, which should be a function taking a single `WebSocket` argument. Keyword arguments `kw...` are the same as supported by [`HTTP.listen`](@ref). Typical usage is like: ```julia WebSockets.listen(host, port) do ws # iterate incoming websocket messages for msg in ws # send message back to client or do other logic here send(ws, msg) end # iteration ends when the websocket connection is closed by client or error end ``` 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻ WebSockets.CloseFrameBody(status, message) Represents the payload of a CLOSE control websocket frame. For error close `status`, it can be wrapped in a `WebSocketError` and thrown. 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻUCheck whether a HTTP.Request or HTTP.Response is a websocket upgrade request/response0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻe WebSockets.isclosed(ws) -> Bool Check whether a `WebSocket` has sent and received CLOSE frames. 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jlڻ WebSockets.open(handler, url; verbose=false, kw...) Initiate a websocket connection to `url` (which should have schema like `ws://` or `wss://`), and call `handler(ws)` with the websocket connection. Passing `verbose=true` or `verbose=2` will enable debug logging for the life of the websocket connection. `handler` should be a function of the form `f(ws) -> nothing`, where `ws` is a [`WebSocket`](@ref). Supported keyword arguments are the same as supported by [`HTTP.request`](@ref). Typical websocket usage is: ```julia WebSockets.open(url) do ws # iterate incoming websocket messages for msg in ws # send message back to server or do other logic here send(ws, msg) end # iteration ends when the websocket connection is closed by server or error end ``` 0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl0ڻZ pong(ws, data=[]) Send a PONG control frame on a websocket connection. `data` is an optional body to send with the message. Note that PING messages are automatically responded to internally by the websocket connection with a corresponding PONG message, but in certain cases, a unidirectional PONG message can be used as a one-way heartbeat. 638.!J496389638.!J49638 A96387?/#96389638,? #self#ws638(Close frame cannot have body of length 1CReceived unfragmented frame while still processing fragmented frame9Continuation frame cannot be the first frame in a message +m    -9638.9638-9638 I -9638 .!J 49638.Q &~6 .9638 I -9638 I -~ 3+.!J 49638.Q&6+.~ I -9638 I  3+ I V.!J 49638 I -~.!J 496386+".< I-96383+# I9638 I .i .| 6%+(.9638.!J 496386(++.9638  .!J 49638 .Q+9638 6,+4.Q9638 6.+4.9638 +9638 -96380-U13+=.v9638 64+=.!J 49638 . F96389638.76768+=.9638 +9638-9638:-U;.!J 49638 .Q=9638 6>+B I3+C I.!J 49638 I .Q 96386D+I-  I.F 3+l.Q 96386I+k.Q 6K+P.9638 +9638-9638M-UN-9638 . 6Q+\.!M-9638S.T.!M.UV I-W-9638 I3+] I+.| 6^+e- .X`.[ I.ab3+f IG I.9638 ]f.!J49638-9638h3+l I-4 A9638   7l+m+m?+$/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?  !!!!!!!!!!""#$$V#self#iobufferfirst_fragment_opcodestatusstpayloadopmasklenextlenflags638ZH A96387?/#96389638,?#self#iobuffer638TH-!M A7?/#96389638,? #self#io638WebSocket connection is closed ?-963867.9638+9638-9638-U7?/#96389638,s? #self#io638 +? -^ -9638.!l I . L I . L A!l I . L6 I A9638.9638  3 I 96389638. K i A F- A 9638   A9638 7++?/#96389638,a/#96389638,b/#96389638,c/#96389638,d/#96389638,f/#96389638,h?E#Frame#2rsv1rsv2rsv3finalopcodeclientpayloadmskextlenlen638k+-^.{ I-!P. O?-!Z6+ I. L. L?.!M.!M.9638  A!x  I ? I.!P . O?-!Z6+37?++?/#96389638,Y/#96389638,Z/#96389638,[/#96389638,\?#self#bytesmaskvali638._&~6-. FV7.f96386-9638. F&~7 -~. F& 7 ?/#96389638,S? #self#l638.!J963849638 A.9638<-96387?/#96389638,A?#self#638+%?6 I 96383 I -9638 6 I 96383 I -9638 . 6 I 96383 I -9638 . 6+ I 96383+ I -9638 .-9638..6+ I96383+ I-9638. . 9638.!"-9638#7$+%+%?/#96389638,1?;#FrameFlags#1rsv1rsv2rsv3finalopcodemaskedlen638O.|96387?/#96389638,?#self#opcode##### #@#638\.!J4j9638.7?/#96389638? #self#x638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x6389638 I. w63.!N I. 7?/#96389638,X? #self#io6389638.!J49638 I. w63.!N I. 7?/#96389638,W? #self#io6389638.!J49638 I. w63.!N I. 7?/#96389638,V? #self#io638a.!J49638-96387?/#96389638,d? #self#c638;7V?/#96389638,S? #self#io638:-96386.!J49638- A9638-U-96386.!J49638-9638 7 7??/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? #self#http638✋ "Connection: close": -/opt/julia/packages/HTTP/sJD5V/src/Streams.jlclose Connection+c.!J49638 A9638963896386+?  I 96389638 I   -!M9638.96386+6 I 9638 I # I A9638   .9638O9638V-9638k6+6 I49638 A96389638 9638    6+6 I9638 .9638w96386+ !9638 I- I+l V+(.!J49638 I.!y9638" I A i I> W3+- W I  A!9638 96389638    > I= ~!6+6 A!i.!@.-!e/60+4 A96389638 9638   3+5 A /96389638 9638   3+69638V.!J49638-7-963869+> A9638-U;3+>3+b V+G-9638-k@6A+E-96383+@ W3+V W I .9638w963896386I+M-96383+M!9638.9638wMN.9638w9638.9638OP6Q+T3+U-9638 ~?-96386V+].!J49638-X A9638-UZ3+b.!J49638-9638]6^+b.!J49638-9638`.!J496387b+c+c?+(/#96389638,j/#96389638,l/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,m/#96389638,o/#96389638,s/#59638,/#59638,/#59638,t,/#59638,u,/#59638,,/#59638,,/#96389638,w/#96389638,y/#96389638,z/#96389638,{/#96389638,|/#96389638,? !!!""""""""##$$%%&&&''((P#self#httpmsgkwargslinefileidlogger_modulegroupstd_levellevelerre638✉️ Read done: 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl`isreadable(c)`/+T-9638-9638k6 06 I-963896383 I9638V.963896389638 -9638U = A!49638    I 96389638 I   -!M9638.96386+@ I 9638  I # I A9638    .9638O 9638V-9638k 6!+@ I49638 A96389638 9638     6$+@ I9638.9638w96386'++!9638 I-) I+6 V+2 I.!y9638 I A i I> W3+7 W I  A!9638 96389638    > I= ~,6+@ A!i.!@8-!e96:+> A96389638 9638    3+? A 996389638 9638    3+@9638V.!J496386A+T9638- . KCD I RE I-96389638G= A!49638I.96389638496386=+N.963896389638-96389638 I 096386P+T-96383+T7?+T+T?+'/#96389638,4/#59638 ,/#96389638,5/#96389638,6/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,7/#96389638,8/#59638!,,/#59638!,,/#59638!,,/#59638!,,/#59638!,,/#59638!,,/#59638!,,/#59638!,,/#96389638,9/#96389638,;?  !"#$%&&&'V#self#ctmsgkwargslinefileidlogger_modulegroupstd_levellevelerr#2task638;7V?/#96389638,K? #self#io638.!J49638-9638-k6.!J49638-9638.!J49638.!J49638.9638-9638.!J49638-9638 A!49638 .!J49638-9638 A!49638 .!J496387?/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,? #self#http638👁 Start read: 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl`!(isreadable(c))`,+C-9638-k-9638k6 06 I-963896383 I9638V.963896389638 -9638U A9638 A!49638 > A!49638  I 96389638 I   -!M9638 .96386+B I 9638  I # I A9638    .9638O9638V-9638k"6#+B I49638 A963896389638   6&+B I9638.9638w96386)+-!9638 I-+ I+ V+4 I.!y9638 I A i I> W3+9 W I  A!963896389638    > I= ~.6+B A!i.!@:-!e;6<+@ A963896389638   3+A A ;963896389638   3+B9638V7?+C+C?+/#96389638,/#59638,/#96389638,/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,? L#self#cmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638;7V?/#96389638,;? #self#io638chunkedUpgradeTransfer-EncodingContent-Length+,.!J49638-9638-k6.!J49638-9638 I-9638.96389638-k 6 +'.96389638-k 6+'.96389638-k6+'.w96386+ I3+ .!J49638 .!J49638 .9638 6+-9638  I.|3+ I= I6+'> A!49638 !.96389638.9638#$3+)-9638 A!49638 '.!J49638 I.9638) A!496387+,+,?/#96389638,A/#96389638,B/#96389638,D/#96389638,E/#96389638,J/#96389638,K/#96389638,M/#96389638,O/#96389638,Q/#96389638,R? #self#httpnm638👁 Start write:1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl`!(iswritable(c))`+A-9638-k-9638k6 06 I-963896383 I9638V.963896389638 -9638U > A!49638   I 96389638 I   -!M9638.96386+@ I 9638  I # I A9638    .9638O9638V-9638k 6!+@ I49638 A96389638 9638    6$+@ I9638.9638w96386'++!9638 I-) I+ V+2 I.!y9638 I A i I> W3+7 W I  A!9638 96389638    > I= ~,6+@ A!i.!@8-!e96:+> A96389638 9638   3+? A 996389638 9638   3+@9638V7?+A+A?+/#96389638,/#59638,/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,? L#self#cmsgkwargslinefileidlogger_modulegroupstd_levellevelerr startwrite(::IO) closewrite(::IO) startread(::IO) closeread(::IO) Signal start/end of write or read operations. 638;7V?/#96389638,&? #self#x638C-^7?/#96389638,'? #self#x638C-7?/#96389638,(? #self#x638O.96387?/#96389638,)? #self#x638O.9638^7?/#96389638,*? #self#x638C-^7?/#96389638,? #self#x638M-96387?/#96389638,+? #self#x638Y.963896387?/#96389638,,? #self#x638x. K9638.w67.w96387?/#96389638,? #self#x./opt/julia/packages/HTTP/sJD5V/src/IOExtras.jlڻsRead from an `IO` stream until `find_delimiter(bytes)` returns non-zero. Return view of bytes up to the delimiter. ./opt/julia/packages/HTTP/sJD5V/src/IOExtras.jlڻ bytes(x) If `x` is "castable" to an `AbstractVector{UInt8}`, then an `AbstractVector{UInt8}` is returned; otherwise `x` is returned. ./opt/julia/packages/HTTP/sJD5V/src/IOExtras.jlڻ IOExtras This module defines extensions to the `Base.IO` interface to support: - `startwrite`, `closewrite`, `startread` and `closeread` for streams with transactional semantics. ./opt/julia/packages/HTTP/sJD5V/src/IOExtras.jlڻE nbytes(x) -> Int Length in bytes of `x` if `x` is `isbytes(x)`. ./opt/julia/packages/HTTP/sJD5V/src/IOExtras.jlڻnwhether `x` is "castable" to an `AbstractVector{UInt8}`; i.e. you can call `bytes(x)` if `isbytes(x)` === true638<7?/#96389638,? #self#x638M-96387?/#96389638,? #self#s638<7?/#96389638,? #self#s638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x? (581  %)+0IKGC4L7;@B&',*- #36:! 9$AD /2"E638i-9638-9638.Q7?/#96389638,? #self#ab638p +& I-9638 I-9638 I-^-^.v67=3.{ I-!P . O?-!Z 6+& I . L. L?.!M .!M .9638-k6+7= I ?3+ I = I ? I.!P . O?-!Z"6#+&37>+&+&?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#ablenbcuacuvali638-9638A-9638Z.{.76.X& 77?/#96389638,? #self#c638+ I A9638 I-!P. O?-!Z6+ I. L. L._&6 .[3+.".&.[.&?.&.[ I.!P . O?-!Z6+3-9638-7++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#bytesiob638I?.& 7?/#96389638,~? #self#c638?-9638A.f6-9638Z.f77=?/#96389638,}? #self#b638?-9638a.f6-9638z.f77=?/#96389638,|? #self#b638: +,-9638A-9638a I.[. K-9638 I- I>-^.{ I-!P . O?-!Z 6 ++ I. L. L?.!M I  I?6+-9638 6+.X  A!x3+3+#-9638 6+#-9638 A!x 3+# -9638- I.Q#$ I.!P . O?-!Z'6(++3-7++,+,?/#96389638,k/#96389638,l/#96389638,m/#96389638,n/#96389638,o/#96389638,p/#96389638,q/#96389638,s/#96389638,u/#96389638,v/#96389638,w? "#self#suppervtoUppervalib638T--96387?/#96389638,z? #self#s638>><<''""&&.96389638 I.9638.96389638 I.9638.96389638 I.9638.96389638 I.9638  .9638 9638 I.9638  7?/#9638 9638 ,]/#9638 9638 ,^/#9638 9638 ,_/#9638 9638 ,`/#9638 9638 ,a/#9638 9638 ,b? #self#io-/opt/julia/packages/HTTP/sJD5V/src/Strings.jlڻ` escapehtml(i::String) Returns a string with special HTML characters escaped: &, <, >, ", ' -/opt/julia/packages/HTTP/sJD5V/src/Strings.jlڻ[ HTTP.ascii_lc_isequal(a::String, b::String) Case insensitive ASCII string comparison. -/opt/julia/packages/HTTP/sJD5V/src/Strings.jlڻ-Case insensitive ASCII character comparison. -/opt/julia/packages/HTTP/sJD5V/src/Strings.jlڻU iso8859_1_to_utf8(bytes::AbstractVector{UInt8}) Convert from ISO8859_1 to UTF8. -/opt/julia/packages/HTTP/sJD5V/src/Strings.jlڻg tocameldash(s::String) Ensure the first character and characters that follow a '-' are uppercase. -/opt/julia/packages/HTTP/sJD5V/src/Strings.jlڻ3Convert ASCII (RFC20) character `c` to lower case. -/opt/julia/packages/HTTP/sJD5V/src/Strings.jlڻ HTTPVersion(major, minor) The HTTP version number consists of two digits separated by a "." (period or decimal point). The first digit (`major` version) indicates the HTTP messaging syntax, whereas the second digit (`minor` version) indicates the highest minor version within that major version to which the sender is conformant and able to understand for future communication. See [RFC7230 2.6](https://tools.ietf.org/html/rfc7230#section-2.6) 638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x#5e=\r4VQc`'1kwn[z<fFo!h&S(H_$+ mta :%O68RTU]@bls^-Y30C*MpEIq> dGyXj/v? DJ,9xN WLgi2 "KuPZ.7)A;B638 .!J963849638 I A-96389638.i-96389638.i-96389638.i-96389638.i -96389638.i 7??/#96389638 ,b/#96389638 ,c/#96389638 ,g/#96389638 ,h/#96389638 ,i/#96389638 ,j/#96389638 ,k/#96389638 ,l? #self#nt  638t++ I- I-96386>+9638? I.!M?.!M I- .Q+6 3+-.s I.X.|96386+.963849638-U I.X3.|6+#- I. w6+ 3+".!N I.  7.963849638-U# I$. w6&+)3++.!N I. )7++++?/#96389638,?/#96389638,@/#96389638,B/#96389638,C/#96389638,D/#96389638,E/#96389638,G/#96389638,H/#96389638,I/#96389638,K/#96389638,L/#96389638,M/#96389638,N/#96389638,Q? "#self#bytesichunk_sizevalx638-^._67.!M-9638 .Q67-96387 ?/#96389638,,? #self#bytes638`+ I-^._963867.|96386 I9638 I-9638.f6 +?.!M-9638 I.Q ?67 I.X37++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,!/#96389638,"/#96389638,#? #self#bytesilval638e? I?.!M-9638 I.Q?6 I.X?.!M-9638 I.Q  ?6 I.X7?/#96389638,/#96389638,/#96389638, /#96389638, /#96389638, ?#self#bytesivalvali638HH?.7?/#96389638,? #self#bytes638\r?\nLmalformed HTTP header detected; attempting to re-encode from Latin-1 to UTF8-/opt/julia/packages/HTTP/sJD5V/src/Parsers.jl` +m I9638. K9638 A K-9638-k6 +7    I96389638 I  -!M9638.96386+3 I 49638 I # I A9638   .9638O 9638V-9638k6+3 I 49638 A96389638 9638     6 +3 I9638 .9638w96386#+'!9638 I-% I+ I9638 I A i6>+3 A!i.!@+-!e,6-+1 A96389638 9638    3+2 A ,96389638 9638    3+39638V-9638-96384 I-96385 I.963896389638.963868+F A9638 A9638.:;.9638. F<= I>. w6@+C3+E.!N I. C7 I.963896389638.96386G+S9638.9638. FIJ IK. w6M+P3+R.!N I. P7 I.963896389638.96386T+e A9638.9638G.9638VW I-9638X A9638.Z.9638. F[\ I]. w6_+b3+d.!N I. b7.963849638-Ue If. w6h+k3+m.!N I. k7+m+m?+#/#9638 9638!,/#9638 9638!,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,T/#5,U/#5,V/#5,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,/#9638 9638!,?  !!!!!!!!!!#######^#self#bytesunfoldremsgkwargslinefileidlogger_modulegroupstd_levellevelbytes0638++. K9638 I.963896389638.9638-k6.963849638-U A9638-9638 A!49638   A9638.  A!49638  .9638  I. w63+.!N I. 7++?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,?#self#bytesresponsere638j+. K9638 I.963896389638.9638-k6.963849638-U A9638 A!49638 A9638 A!49638  A9638-9638  A!49638  .9638  I. w63+.!N I. 7++?/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,?#self#bytesrequestre638E +0? I-^ I.D9638 I.f6+, ?.!M I  I ?.Q & 63.Q & 6+).-< I. I .9638.Q 6+3+.Q 9638 6+7-k6+(.Q 9638 6 +$ I  3+% I .Q 9638 6 +(.963849638-U&3+* I I.X3.|96386,+0-963849638-U.7+0+0?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? A#find_end_of_header#1allow_obs_foldbytesilbufvalbuf16x638S A9638>7?/#96389638,? #self#bytes638^ \r? \n I-96389638-96387?/#96389638,/#96389638,? #self#r638=^ ([!#$%&'*+\-.^_`|~[:alnum:]]+) : # 1. field-name = token (RFC7230 3.2.6) [ \t]* # OWS ([^\r\n]* # 2. field-value (?: \r? \n [ \t] [^\r\n]*)*) # obs-fold [ \t]* # OWS \r? \n # CRLF  I-96389638-96387?/#96389638,t/#96389638,|? #self#r638G^ ([!#$%&'*+\-.^_`|~[:alnum:]]+) : # 1. field-name = token (RFC7230 3.2.6) [ \t]* # OWS ([^\r\n]*?) # 2. field-value [ \t]* # OWS \r? \n # CRLF (?= [^ \t]) # no WS on next line  I-96389638-96387?/#96389638,b/#96389638,j? #self#r638^ [ ]? # Issue #190 HTTP/(\d\.\d) [ ]+ # 1. version (\d\d\d) .* # 2. status \r? \n # CRLF  I-96389638-96387?/#96389638,S/#96389638,Y? #self#r638^ (?: \r? \n) ? # ignore leading blank line ([!#$%&'*+\-.^_`|~[:alnum:]]+) [ ]+ # 1. method = token (RFC7230 3.2.6) ([^.][^ \r\n]*) [ ]+ # 2. target HTTP/(\d\.\d) # 3. version \r? \n # CRLF  I-96389638-96387?/#96389638,?/#96389638,F? #self#r638!9638.!J49638--96387?/#96389638,7/#96389638,7/#96389638,7? #self#r-/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻohttps://tools.ietf.org/html/rfc7230#section-3.1.1 request-line = method SP request-target SP HTTP-version CRLF -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻParse HTTP request-line `bytes` and set the `method`, `target` and `version` fields of `request`. Return a `SubString` containing the header-field lines. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻ'Find `\n` after chunk size in `bytes`. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻg find_end_of_header(bytes) -> length or 0 Find length of header delimited by `\r\n\r\n` or `\n\n`. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻbhttps://tools.ietf.org/html/rfc7230#section-3.2 header-field = field-name ":" OWS field-value OWS -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻhttps://tools.ietf.org/html/rfc7230#section-3.1.2 status-line = HTTP-version SP status-code SP reason-phrase CRLF See: [#190](https://github.com/JuliaWeb/HTTP.jl/issues/190#issuecomment-363314009) -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻParse HTTP header-field. Return `Pair(field-name => field-value)` and a `SubString` containing the remaining header-field lines. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻ>Arbitrary limit to protect against denial of service attacks. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻRhttps://tools.ietf.org/html/rfc7230#section-3.2.4 obs-fold = CRLF 1*( SP / HTAB ) -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻThe parser separates a raw HTTP Message into its component parts. If the input data is invalid the Parser throws a `HTTP.ParseError`. The `parse_*` functions processes a single element of a HTTP Message at a time and return a `SubString` containing the unused portion of the input. The Parser does not interpret the Message Headers. It is beyond the scope of the Parser to deal with repeated header fields, multi-line values, cookies or case normalization. The Parser has no knowledge of the high-level `Request` and `Response` structs defined in `Messages.jl`. However, the `Request` and `Response` structs must have field names compatible with those expected by the `parse_status_line!` and `parse_request_line!` functions. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻParse HTTP chunk-size. Return number of bytes of chunk-data. chunk-size = 1*HEXDIG [RFC7230 4.1](https://tools.ietf.org/html/rfc7230#section-4.1) -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻ>Arbitrary limit to protect against denial of service attacks. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻ find_end_of_trailer(bytes) -> length or 0 Find length of trailer delimited by `\r\n\r\n` (or starting with `\r\n`). [RFC7230 4.1](https://tools.ietf.org/html/rfc7230#section-4.1) -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻParse HTTP response-line `bytes` and set the `status` and `version` fields of `response`. Return a `SubString` containing the header-field lines. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻw ParseError <: Exception Parser input was invalid. Fields: - `code`, error code - `bytes`, the offending input. -/opt/julia/packages/HTTP/sJD5V/src/Parsers.jlڻ>Arbitrary limit to protect against denial of service attacks. 638z+!9638.!J49638.!J49638 I-.s.X.d!9638.!J 49638.Q 6 7.s.X.d.X.s.X.d.X.9638 A96387++?/#96389638,$/#96389638,%?#self#irebytesdefaultp638!9638.!J49638.!J49638 I-.s.X.d.X.s.X .d  .X .9638 A9638 7?/#96389638,/#96389638, ?#self#irebytesp638!9638.!J49638.!J49638-.d.X.96387?/#96389638,?#self#rebytes638!9638.!J49638.!J49638.!J49638.[.!J49638.!J49638.!J49638 A7 ?/#96389638?#self#rebytesoffset638IH A7?/#96389638?#self#rebytes638.!J49638.!J49638.!J49638.!J49638- A!496387??/#96389638/#96389638? #self#re 0R A !963887@@`?'//#9638?638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x )EPjyMa TZxIq\'($"/e;kBzWw@ 9]f=#XRSg{n *^rN|!vt}?.%U-YCim0&o75ObcGd+1s2D638L-!M96387?/#96389638,?#self#638 I R9638.!J49638 AQ496387?/#96389638,?#self#req#25638.!J49638.49638-k6.!J963849638-.!J49638 A!x49638. L49638- 7 ?/#96389638,/#96389638,/#96389638,? #self#req638nH9638- . K I R7?/#96389638,?#self#handler#23638 I-9638.OV673 AQ7?/#96389638,/#96389638,/#96389638,?#self#reqnamedefaultparams638LH AV7?/#96389638,?#self#reqname638h.!J49638 AQ49638V7?/#96389638,? #self#req638h.!J49638 AQ49638V7?/#96389638,? #self#req638 +/.!J49638 I-96389638. K i- F=-9638.!J49638 I A  9638/.!J49638.!J49638 I A9638   I A9638 .w9638 6+..!J49638 -e-k6+*.!J49638 I-!P. O?-!Z6+*. L.!l I . L I . L A!l I . L . L.!M A!x# I.!P". O?-!Z&6'+*3+.!J49638 .!J49638 A F*+7, A FG7.+/+/?/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,/#9638 9638,? ,#self#rreqparamsleafsegmentsurlvi0 ( 638*b A963896387?/#96389638,?#self#rpathhandler638 I96389638. K i- F=- A 96389638/ I..!J49638.? V6 .!J49638 I- .!J49638 A K-!M A9638 A96387??/#96389638 ,z/#96389638 ,{/#96389638 ,|/#96389638 ,~/#96389638 ,?.#self#rmethodpathhandlersegmentshandler638M-9638+7?/#96389638,b?#self##unused#638P.9638+7?/#96389638,d? #self#s638M-9638+7?/#96389638,a?#self##unused#638P.9638+7?/#96389638,c? #self#s638P.!J496387?/#96389638,? #self#x638*e.Q963867.Q7?/#96389638,? #self#xy638P.!J496387?/#96389638,? #self#x638 +m     -^.| 6 +".!J49638-e 6 7V9638. K i I R9638 I R9638. F-9638.!J49638 I A .O V6+73+".!J49638.!M 7 I .!M I =9638. K i$ I R9638- F'-%(9638 .!J49638 I A )*+,.? V6.+9.!J49638.!M0 .X I A963812 I .O  I .9638  V.? V66+97 .!J49638 I-!P9. O?-!Z;6<+T I. L>. L>!9638.!J49638 .!JB49638 .AC .?DV6E+O.X I A9638GH I .O  I .9638  V.? V6L+O7 I.!P9@. O?-!ZP6Q+T3+>.!J49638 .?TV6U+_.!J49638 .X I A9638WX I .O  I .9638  V.? V6\+_7 .!J49638.?_V6`+k.!J49638-^.Xc I A9638bd I .O  I .9638  V.? V6h+k7 6 +m77V+m+m?+%/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638, /#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638, /#96389638,"/#96389638,$/#96389638,%/#96389638,&/#96389638,'/#96389638,(/#96389638,+/#96389638,,/#96389638,-/#96389638,./#96389638,//#96389638,0/#96389638,1/#96389638,4/#96389638,5/#96389638,6/#96389638,7/#96389638,8/#96389638,9/#96389638,<?  !"##$%%%G#self#nodemethodsegmentsi#19#18#17manymissingjsegmentnode638P.!J496387?/#96389638,? #self#x638P.!J496387?/#96389638,? #self#x638d.!J49638.!J496387?/#96389638,? #self#x638*e.Q963867.Q7?/#96389638,? #self#xy638P.!J496387?/#96389638,? #self#x638segment isa String0/** double wildcard must be last segment in path***"" route with new path = " => "%replacing existing registered route; ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jl+     -^.| 6 +Y9638. K i I R9638 I R9638 . F- 9638.!J49638.!J49638 I A .O V6+.!J49638.3+X I96389638 I-!M9638.9638'(6)+U I49638 I# I A9638 .9638O9638V-9638k.6/+U I49638 A96389638 9638 62+U I9638.9638w963865+9!9638 I-7 I+ V+G.!J49638.!M; .!J<49638.!J49638.!M> .!J?49638.!J49638 I A!y9638=9638@9638A9638 I A i I> W3+L W I  A!9638 96389638> I= ~:6+U A!i.!@M-!eN6O+S A96389638 96383+T A N96389638 96383+U9638V.!J49638 A!xV 7? I .!M.w 96386Z+`.!J49638.!J 49638. F].\^.Q 96386`+c3+j.w 96386c+h.!J 49638 I.OeV3+i I=6+s.!J49638.OjV6k+o-9638 A!49638m.!J49638.X A9638op7q.Q 96386s+.!J49638 .OuV6v+z-9638 A!49638 x-^._z6{+~-I9638!.!J49638 .X A9638~7.w 96386+9638". K i I R9638#- F-9638.!J 49638.!J49638$ I A .O V6+ I -9638 .!J49638$. 3+.!J49638$ I .!M  .X A96387.w 6+3+-!l9638%-!U9638". K i I R9638&- F-9638 .!J49638' I A .O V6+ I -9638 .!J49638'. 9638". K i I R9638(- F-9638).!J49638' A  .X A96387.!J49638'.!M .X A96387++?+:/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,/#96389638*,?  !!!!"""""""""###$$%%%%&&'''(()))*++++,,----------../0011222233334444444444556778888888889999:::::|#self#nodeleafsegmentsi#11#10#9#8#7nsegmentjmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638 HH+?-9638 I-!P. O?-!Z6+. L.!l I . L I. L A!l I . L . L- .67 3 I.!P. O?-!Z6+37V++?/#96389638,/#96389638,/#96389638,/#96389638,?#find#6byeqyitrxi638[ A9638mQ7?/#96389638,? #self#yitr638r-96386-96387-7?/#96389638,? #self#x638}{.963896386.9638963877=?/#96389638,? #self#x^{([^:{}]+)(?::(.*))?}$638?6 I3 I-9638 A!i.!@-!e6 .!J963849638- F A }!P  7 .!J963849638 A F A }!P 7?/#96389638,?#serve!#5streamkwfargs638}9638 A i-! A F= A }!P7?/#96389638,?#self#fargs638?6 I3 I-9638 A!i.!@-!e6 .!J963849638- F A }!P  7 .!J963849638 A F A }!P 7?/#96389638,?#serve#4streamkwfargs638}9638 A i-! A F= A }!P7?/#96389638,?#self#fargs638D`RequestHandlerFunction` is deprecated, use `streamhandler` instead.\ ?? 9638-9638.!J49638.!J49638.!J49638.!96389638 A!i.!@ -!e 6 A }!P96387 . F 9638 A }!P 7?/#96389638,r/#96389638,s/#96389638,t?'#RequestHandlerFunction#3kwargsargs638y ?9638 A i-!. F A }!P7?/#96389638,q? #self#args638+.!J49638 I. w963863.!N9638 I. 9638 I- A!49638 -9638.!J49638.  9638. L49638- A!49638.!J49638 A!49638-9638.!J49638.!J49638.[7?++?/#9638 9638 ,7/#9638 9638 ,8/#9638 9638 ,9/#9638 9638 ,:/#9638 9638 ,;/#9638 9638 ,</#9638 9638 ,=/#9638 9638 ,>?#self#streamrequest638nH9638- . K I R7?/#96389638,6?#self#handler#1./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ Handler Abstract type for the handler interface that exists for documentation purposes. A `Handler` is any function of the form `f(req::HTTP.Request) -> HTTP.Response`. There is no requirement to subtype `Handler` and users should not rely on or dispatch on `Handler`. A `Handler` function `f` can be passed to [`HTTP.serve`](@ref) wherein a server will pass each incoming request to `f` to be handled and a response to be returned. Handler functions are also the inputs to [`Middleware`](@ref) functions which are functions of the form `f(::Handler) -> Handler`, i.e. they take a `Handler` function as input, and return a "modified" or enhanced `Handler` function. For advanced cases, a `Handler` function can also be of the form `f(stream::HTTP.Stream) -> Nothing`. In this case, the server would be run like `HTTP.serve(f, ...; stream=true)`. For this use-case, the handler function reads the request and writes the response to the stream directly. Note that any middleware used with a stream handler also needs to be of the form `f(stream_handler) -> stream_handler`, i.e. it needs to accept a stream `Handler` function and return a stream `Handler` function. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ HTTP.Handlers.cookie_middleware(handler) -> handler Middleware that parses and stores any cookies in the incoming request in the request context. Cookies can then be retrieved by calling [`HTTP.getcookies(req)`](@ref) in subsequent middlewares/handlers. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ HTTP.getroute(req) -> String Retrieve the original route registration string for a request after its url has been matched against a router. Helpful for metric logging to ignore matched variables in a path and only see the registered routes. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ% HTTP.getparam(req, name, default=nothing) -> String Retrieve a matched path parameter with name `name` from request context. If a path was registered with a router via `HTTP.register!` like "/api/widget/{id}", then the path parameter can be retrieved like `id = HTTP.getparam(req, "id"). ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ! HTTP.register!(r::Router, method, path, handler) HTTP.register!(r::Router, path, handler) Register a handler function that should be called when an incoming request matches `path` and the optionally provided `method` (if not provided, any method is allowed). Can be used to dynamically register routes. When a registered route is matched, the original route string is stored in the `request.context[:route]` variable. The following path types are allowed for matching: * `/api/widgets`: exact match of static strings * `/api/*/owner`: single `*` to wildcard match anything for a single segment * `/api/widget/{id}`: Define a path variable `id` that matches any valued provided for this segment; path variables are available in the request context like `HTTP.getparams(req)["id"]` * `/api/widget/{id:[0-9]+}`: Define a path variable `id` that does a regex match for integers for this segment * `/api/**`: double wildcard matches any number of trailing segments in the request path; the double wildcard must be the last segment in the path ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ} HTTP.serve!(args...; kw...) -> HTTP.Server Non-blocking version of [`HTTP.serve`](@ref); see that function for details. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ streamhandler(request_handler) -> stream handler Middleware that takes a request handler and returns a stream handler. Used by default in `HTTP.serve` to take the user-provided request handler and process the `Stream` from `HTTP.listen` and pass the parsed `Request` to the handler. Is included by default in `HTTP.serve` as the base "middleware" when `stream=false` is passed. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ? HTTP.getparams(req) -> Dict{String, String} Retrieve any matched path parameters from the request context. If a path was registered with a router via `HTTP.register!` like "/api/widget/{id}", then the path parameters are available in the request context and can be retrieved like `id = HTTP.getparams(req)["id"]`. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ= Middleware Abstract type for the middleware interface that exists for documentation purposes. A `Middleware` is any function of the form `f(::Handler) -> Handler` (ref: [`Handler`](@ref)). There is no requirement to subtype `Middleware` and users should not rely on or dispatch on the `Middleware` type. While `HTTP.serve(f, ...)` requires a _handler_ function `f` to be passed, middleware can be "stacked" to create a chain of functions that are called in sequence, like `HTTP.serve(base_handler |> cookie_middleware |> auth_middlware, ...)`, where the `base_handler` `Handler` function is passed to `cookie_middleware`, which takes the handler and returns a "modified" handler (that parses and stores cookies). This "modified" handler is then an input to the `auth_middlware`, which further enhances/modifies the handler. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻb HTTP.Router(_404, _405, middleware=nothing) Define a router object that maps incoming requests by path to registered routes and associated handlers. Paths can be registered using [`HTTP.register!`](@ref). The router object itself is a "request handler" that can be called like: ``` r = HTTP.Router() resp = r(request) ``` Which will inspect the `request`, find the matching, registered handler from the url, and pass the request on to be handled further. See [`HTTP.register!`](@ref) for additional information on registering handlers based on routes. If a request doesn't have a matching, registered handler, the `_404` handler is called which, by default, returns a `HTTP.Response(404)`. If a route matches the path, but not the method/verb (e.g. there's a registerd route for "GET /api", but the request is "POST /api"), then the `_405` handler is called, which by default returns `HTTP.Response(405)` (method not allowed). A `middleware` ([`Middleware`](@ref)) can optionally be provided as well, which will be called after the router has matched the request to a route, but before the route's handler is called. This provides a "hook" for matched routes that can be helpful for metric tracking, logging, etc. Note that the middleware is only called if the route is matched; for the 404 and 405 cases, users should wrap those handlers in the `middleware` manually. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ HTTP.getcookies(req) -> Vector{Cookie} Retrieve any parsed cookies from a request context. Cookies are expected to be stored in the `req.context[:cookies]` of the request context as implemented in the [`HTTP.Handlers.cookie_middleware`](@ref) middleware. ./opt/julia/packages/HTTP/sJD5V/src/Handlers.jlڻ HTTP.serve(handler, host=Sockets.localhost, port=8081; kw...) HTTP.serve(handler, port::Integer=8081; kw...) HTTP.serve(handler, server::Base.IOServer; kw...) HTTP.serve!(args...; kw...) -> HTTP.Server Listen for HTTP connections and execute the `handler` function for each request. Listening details can be passed as `host`/`port` pair, a single `port` (`host` will default to `localhost`), or an already listening `server` object, as returned from `Sockets.listen`. To open up a server to external requests, the `host` argument is typically `"0.0.0.0"`. The `HTTP.serve!` form is non-blocking and returns an `HTTP.Server` object which can be `wait(server)`ed on manually, or `close(server)`ed to gracefully shut down the server. Calling `HTTP.forceclose(server)` will immediately force close the server and all active connections. `HTTP.serve` will block on the server listening loop until interrupted or and an irrecoverable error occurs. The `handler` function should be of the form `f(req::HTTP.Request)::HTTP.Response`. Alternatively, passing `stream=true` requires the `handler` to be of the form `f(stream::HTTP.Stream) -> Nothing`. See [`HTTP.Router`](@ref) for details on using it as a request handler. Optional keyword arguments: - `sslconfig=nothing`, Provide an `MbedTLS.SSLConfig` object to handle ssl connections. Pass `sslconfig=MbedTLS.SSLConfig(false)` to disable ssl verification (useful for testing). Construct a custom `SSLConfig` object with `MbedTLS.SSLConfig(certfile, keyfile)`. - `tcpisvalid = tcp->true`, function `f(::TCPSocket)::Bool` to check if accepted connections are valid before processing requests. e.g. to do source IP filtering. - `readtimeout::Int=0`, close the connection if no data is received for this many seconds. Use readtimeout = 0 to disable. - `reuseaddr::Bool=false`, allow multiple servers to listen on the same port. Not supported on some OS platforms. Can check `HTTP.Servers.supportsreuseaddr()`. - `server::Base.IOServer=nothing`, provide an `IOServer` object to listen on; allows manually closing or configuring the server socket. - `verbose::Bool=false`, log connection information to `stdout`. - `access_log::Function`, function for formatting access log messages. The function should accept two arguments, `io::IO` to which the messages should be written, and `http::HTTP.Stream` which can be used to query information from. See also [`@logfmt_str`](@ref). - `on_shutdown::Union{Function, Vector{<:Function}, Nothing}=nothing`, one or more functions to be run if the server is closed (for example by an `InterruptException`). Note, shutdown function(s) will not run if an `IOServer` object is supplied to the `server` keyword argument and closed by `close(server)`. ```julia # start a blocking echo server HTTP.serve("127.0.0.1", 8081) do req return HTTP.Response(200, req.body) end # non-blocking server server = HTTP.serve!(8081) do req return HTTP.Response(200, "response body") end # can gracefully close server manually close(server) ``` 638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x8!3"LMI7B KFJO%;1&: @N638 unreachabled +Y I -9638-k6+5.!J49638-96386 +(.!J49638-^ .| 6 +#9638. K i.!J49638-^. F>-9638.!J49638 I A .w96386+ I .[3+". K96389638.w6+! I .96383+"-I9638 3+'- A!49638#.!J49638 I -^%3+4.!J49638!9638 .w()6*+2. K96389638.w,6-+2.!J49638 I .9638/3+4.!J49638 I .[23+E I-!c V+? I +-.!J49638 .!J:49638 A!x;949638 W3+A W I -!9638. O 6B+E A! I-!c V+R I +.!J49638 .!JI49638  A!xJK49638 I M I W3+T W I -!9638. O 6U+X A! 7X+Y+Y?+/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#59638,/#59638, /#59638, /#59638, /#59638,/#59638, /#96389638,/#59638,,/#59638, ,/#59638, ,/#59638, ,/#59638,,/#59638, ,? 9#self#streamresbuf_or_streamlocktemptempbodyn6387 V I+. L49638. L49638 I.[ I W3 W I. L49638- . O6 A!7?/#96389638,/#96389638,/#96389638,/#96389638,? #self#638gzipContent-Encoding +.O>63.OV6.96389638 I .Q 96383 I =6 + I A9638 I-96389638- -  A K I R I -!96386=+.!96389638 -!9638  I A9638 -9638 7 A9638 7++?/#9638 9638 ,z/#9638 9638 ,~/#9638 9638 ,/#9638 9638 ,/#5z,/#5z, /#5z, /#5z, /#5z, /#5z,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,? <#self#streamresdecompresslocktskgzstreambuf#6task638H.[7?/#96389638,w?#self#streambody638Q.96387?/#96389638,v?#self#streambody638Q.96387?/#96389638,u?#self#streambody638V I I-!P. O?-!Z6 I. L. L.9638 I.X  I.!P . O?-!Z637?/#96389638,e/#96389638,f/#96389638,g/#96389638,h/#96389638,i?#self#streambodynchunk638m.!J963849638-.[7?/#96389638,r?#self#streambody638H.[7?/#96389638,m?#self#streambody638+.!J49638-9638-k6.!J49638 I.9638-96383.!J49638 I.[ I-!c V+ I+.!J49638 A!x49638 W3+ W I-!9638. O6+ A!7++?/#96389638,X/#96389638,Y/#96389638,Z/#96389638,\/#96389638,^/#59638 ,/#59638 , /#59638 , /#59638 , /#59638,_/#59638 , /#96389638,a? #self#streamreqlocktempn@/opt/julia/packages/HTTP/sJD5V/src/clientlayers/StreamRequest.jlڻ streamlayer(stream) -> HTTP.Response Create a [`Stream`](@ref) to send a `Request` and `body` to an `IO` stream and read the response. Send the `Request` body in a background task and begins reading the response immediately so that the transmission can be aborted if the `Response` status indicates that the server does not wish to receive the message body. [RFC7230 6.5](https://tools.ietf.org/html/rfc7230#section-6.5). 638client closereadclient startread@/opt/julia/packages/HTTP/sJD5V/src/clientlayers/StreamRequest.jl + V+> I+ I 96389638 I   -!M9638.9638 6++ I 9638 I# I A9638  .9638O9638V-9638k6++ I49638 A963896389638  6++ I9638.9638w96386+!9638 I- I+3 I9638 I A i6>++ A!i.!@#-!e$6%+) A963896389638   3+* A $963896389638   3++9638V. L49638 -9638 ,. L49638 -9638.-k/60+8. L49638 . L49638. L49638. L4c I A963823453+9 I? I9 I W3+@ W I I . L4c-!c V+Q I+. L49638.!JD49638 AQE496389638 A9638. L49638.[GH.sI+.XFJ. L49638.!JL49638 A!xMK49638 W3+S W I-!9638 . O6T+W A!  I96389638 I-!M9638.9638ab6c+ I9638 I# I A9638.9638O9638V-9638kh6i+ I49638 A9638963896386l+ I9638.9638w96386o+s!9638 I-q I+< I 9638 I A i6>+ A!i.!@w-!ex6y+} A963896389638  3+~ A x963896389638  3+9638V. L49638 -9638. O6+ A!7++?+6/#96389638/#59638,3/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,T/#5,U/#5,V/#5,/#59638,4/#59638,5/#59638,6/#59638,9/#59638,,/#59638, ,/#59638, ,/#59638, ,/#59638,:,/#59638, ,/#59638,</#5,~,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,T,!/#5,U,!/#5,V,!/#5,,!/#59638,=?  """"""""#$%%%%&'()))*++,--../234444444566#self#msgkwargslinefileidlogger_modulegroupstd_levelleveltempmsgkwargslinefileidlogger_modulegroupstd_levellevel638client closewrite@/opt/julia/packages/HTTP/sJD5V/src/clientlayers/StreamRequest.jl+R V I +. L49638. L49638. L4c A9638 I I W3 W I I. L4c-!c V+ I+. L49638.!J49638 AQ496389638 A9638. L49638.[.s+.X. L49638.!J49638 A!x49638 W3+ W I-!9638. O6!+$ A!  I 9638 9638 I   -!M9638 .9638 ./60+L I 9638  I # I A9638    .9638 O9638 V-9638 k566+L I49638 A9638 96389638   69+L I9638.9638 w9638 6<+@!9638 I-> I+. I9638 I A i6>+L A!i.!@D-!eE6F+J A9638 96389638   3+K A E9638 96389638   3+L9638 V. L49638-9638M. O 6O+R A!7+R+R?+/#96389638/#59638,)/#59638,+/#59638,/#59638, /#59638, /#59638, /#59638,,/#59638, /#59638,./#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,T/#5,U/#5,V/#5,/#59638,/? L#self#tempmsgkwargslinefileidlogger_modulegroupstd_levellevel638 HTTP.IOError.body: client startwrite@/opt/julia/packages/HTTP/sJD5V/src/clientlayers/StreamRequest.jl.*jH+? 9638 I .!J 49638 I .!J 49638  I96389638 I-!M9638.96386+7 I9638 I# I A9638.9638O9638V-9638k6+7 I49638 A96389638 9638 6+7 I9638 .9638w96386+"!9638 I-  I+ V+) I -9638  I A i Ia> W3+. W I  A!9638 96389638> Ia= ~#6a+7 A!i.!@/-!e061+5 A96389638 9638 3+6 A 096389638 9638 3+79638V I!96389638 I ! -!M9638.9638BC6D+` I9638 I# I A9638 .9638O9638V-9638kI6J+` I49638 A96389638 9638 !6M+` I9638 .9638w96386P+T!9638 I-R I+ I9638 I A i6>+` A!i.!@X-!eY6Z+^ A96389638 9638!3+_ A Y96389638 9638!3+`9638V I A9638-9638 "#$%&'() I+96389638 I*+*-!M9638.9638mn6o+ I)9638 I(# I' A9638*)(.9638O'9638V-9638kt6u+ I&49638 A96389638 9638 '+()&6x+ I%9638 .9638w%96386{+!9638 I%-}% I$+ V+ I".9638b I# A i Ib> W3+ W I,  A!9638 96389638'+()&%$,> Ib= ~6b+ A!i.!@#-!e6+ A96389638 9638'+"()&%$3+ A 96389638 9638'+"()&%$3+9638V.OV6+.!J 49638-9638-k6+-./01234 I696389638 I565-!M9638.96386+ I49638 I3# I2 A9638543.9638O29638V-9638k6+ I149638 A96389638 9638 263416+ I09638 .9638w096386+!9638 I0-0 I/+ V+- .!J 49638-9638  I- A!y9638 I. A i Ic> W3+ W I7  A!9638 96389638263410/7> Ic= ~6c+ A!i.!@.-!e6+ A96389638 963826-3410/3+ A 96389638 963826-3410/3+9638V V+-!9638!963889: I;.OV6+  I: A96389638-  -  -  - : A K  I< R :< I=-96389638= A!=49638 =96389638! A.96389638"6>+.96389638#;=-96389638$== I9 A96389638%- -  -  -  - 9- : A K  9 I> R :> I?-96389638= A!?49638 ?96389638! A).96389638")6>+.96389638#;?-96389638$?? Id)3+ V+ Ie+ If- W3+ W Ie-9638& -9638' . Oe6)+ A! Idf I8d-!9638(;8 W3+c W.OV6)+3+"-!M-k)6) +a.!J 49638) AQ)"49638*.X)#.!J 49638) A!x)%)$49638*6+a@ABCDEFG II96389638+ IHIH-!M9638.9638)2)36)4+` IG49638, IF# IE A9638HGF.9638OE9638V-9638k)96):+` ID49638- A96389638 9638 EIFGD6)=+` IC9638 .9638wC96386)@+D!9638 IC-)BC IB+L V+R I@ A9638.9638/. K i)G-g96380.!J 496381.!J 496382.!J 49638) A F)I)J)K)L IA-)H)M Ig> W3+W W IJ  A!9638 96389638EIFGDCBJ> Ig= ~)E6g+` A!i.!@)XA-!e)Y6)Z+^ A96389638 9638EI@FGDCB3+_ A )Y96389638 9638EI@FGDCB3+`9638V A ~KLMNOPQR IT96389638 ISTS-!M9638.9638)m)n6)o+ IR9638 IQ# IP A9638SRQ.9638OP9638V-9638k)t6)u+ IO496383 A96389638 9638 PTQRO6)x+ IN9638 .9638wN96386){+!9638 IN-)}N IM+R V+ IK-9638  IL A i Ih> W3+ W IU  A!9638 96389638PTQRONMU> Ih= ~)6h+ A!i.!@)L-!e)6)+ A96389638 9638PTKQRONM3+ A )96389638 9638PTKQRONM3+9638VVWXYZ[\] I_96389638 I^_^-!M9638.9638))6)+ I]9638 I\# I[ A9638^]\.9638O[9638V-9638k)6)+ IZ496384 A96389638 9638 [_\]Z6)+ IY9638 .9638wY96386)+!9638 IY-)Y IX+S V+ IV.9638b IW A i Ii> W3+ W I`  A!9638 96389638[_\]ZYX`> Ii= ~)6i+ A!i.!@)W-!e)6)+ A96389638 9638[_V\]ZYX3+ A )96389638 9638[_V\]ZYX3+9638V Ij . wj6)+3+.!Nj Ij. )7j++?+/#9638596386,/#9638596386,/#9638596386,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638596386,/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,T,/#5,U,/#5,V,/#5,,/#9638596386,/#9638596386,/#9638596386,/#5,~,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,s,2/#5,t,2/#5,u,2/#5,v,2/#5,x,2/#5,y,2/#5,,2/#9638596386,/#9638596386,/#5,~,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,,K/#5,s,K/#5,t,K/#5,u,K/#5,v,K/#5,x,K/#5,y,K/#5,,K/#9638596386,"/#9638596386,#/#5z,,d/#5z,,d/#596386,$,f/#596386,',f/#596386,(,f/#596387,,i/#596387,,i/#596387,,i/#596387,,i/#596387,,i/#596387,,i/#596387,,i/#596387,,i/#596386,1,f/#596386,2,f/#596387,,s/#596387,,s/#596387,,s/#596387,,s/#596387,,s/#596387,,s/#596387,,s/#596387,,s/#596386,@,f/#596386,A,f/#596386,C,f/#596386,D,f/#5z,,d/#5z,,d/#9638596386,I/#9638596386,J/#9638596386,K/#9638596386,L/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#9638596386,O/#9638596386,R/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#9638596386,S/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#9638596386,T?  !"###$%%&''((),-......./0133333333456666789:::;<<=>>??@CDEFFFFFGHHHHHHHHHIJJJJJJLLLLLLLLMNOOOOPQRSSSTUUVWWXXY\]]]]^_____`aaaaaaaaabceeeeegghkkkkkkkkkkkllmmmmnopqruuuuuuuuuuuuuuvvwwwwxyz{s||}}}}}~dddZ#streamlayer#1iofunctiondecompresslogerrorslogtagtimedoutkwstreamwrite_startreqresponsemsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrvread_startlocksync#48#2task#3taskmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638}VVVV A i-! A9638=7?/#96389638,?#self#stream638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x2=P3&RMNV[ce6^0 8;?TX1Y \dC 4B.)A*-DQ5_@W9+KO "'EF $7HGJZ]`a%bhI(! /:,638CONNECTProxy-AuthorizationHost📡 CONNECT HTTPS tunnel to D/opt/julia/packages/HTTP/sJD5V/src/clientlayers/ConnectionRequest.jl:.+G.!J963849638.!J49638-.!J49638 I A!y9638      I96389638 I-!M9638.96386+: I9638 I# I A9638 .9638O9638V-9638k6+: I 49638 A96389638 9638  6+: I 9638 .9638w 96386!+%!9638 I -# I + V+, I .!y9638 I A i I> W3+1 W I  A!9638 96389638   > I= ~&6+: A!i.!@2 -!e364+8 A96389638 9638    3+9 A 396389638 9638    3+:9638V.9638 I-; I.96389638-e-k>6?+B A!x9638 I A96389638.9638.!J49638.9638D.!J496387F+G+G?+!/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?  !!w#self#iotarget_urlreqrequestauthheaderstargetmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638 Make them match or provide only one of them. - the socket type MbedTLS.SSLContext is configured by MbedTLS.SSLConfig - the socket type OpenSSL.SSLStream is configured by OpenSSL.SSLContext typeof(sslconfig)=\Incompatible values for keyword args `socket_type_tls` and `sslconfig`: socket_type_tls= ?- I A!y963896389638--U7?/#96389638,/#96389638,?%#self#socket_type_tlssslconfigmsg638Z X+>96389638.w6 I96389638396389638.w 6 I963896383 IV I I.O6+$-96386+-!M9638 I. w6+3+.!N I. 7 I . w 6+!3+#.!N I . !7 -96386$+- I . w 6'+*3+,.!N I . *7 -96386-+6 I . w 60+33+5.!N I . 37 I R9638. I 7. w 69+<3+>.!N I . <7 +>+>?/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,? K#self#socket_type_tlssslconfigerrsocket_type_matching_sslconfig638httpswss.!J49638. F96389638.76.963877?/#96389638,/#96389638,/#96389638,?5#self#urlsocket_type_tcpsocket_type_tlssslconfigD/opt/julia/packages/HTTP/sJD5V/src/clientlayers/ConnectionRequest.jlڻi tls_socket_type(socket_type_tls, sslconfig)::Type Find the best TLS socket type, given the values of these keyword arguments. If both are `nothing` then we use the global default: `HTTP.SOCKET_TYPE_TLS[]`. If both are not `nothing` then they must agree: `sslconfig` must be of the right type to configure `socket_type_tls` or we throw an `ArgumentError`. D/opt/julia/packages/HTTP/sJD5V/src/clientlayers/ConnectionRequest.jlڻ connectionlayer(handler) -> handler Retrieve an `IO` connection from the Connections. Close the connection if the request throws an exception. Otherwise leave it open so that it can be reused. 638 . L49638.!J49638.!J49638.!J49638.!J49638.96389638VV-!M9638 A i-! A+=   7 ?/#96389638,<? #self#req638 . Closing: ❗️ ConnectionLayer HTTP.ConnectionRequestHTTP.StatusErrorhttpswsswsHTTP.ConnectErrorBasic )Adding Proxy-Authorization: Basic header.D/opt/julia/packages/HTTP/sJD5V/src/clientlayers/ConnectionRequest.jlProxy-Authorizationhttp3u +? Ih I A 9638 I A 9638.?V6 +Y.!J 49638 A 49638 I-9638. 04963863+SS. L49638.!J49638.Q96386+!. 0496386+3+TT. L49638-y A! 49638.!J49638 I-9638!-e-k#6$+X.!J 49638 .9638 &9638 -k'6(+X I9638 9638 I-!M9638.9638 4566+R I9638 I# I A9638.9638 O9638 V-9638 k;6<+R I49638 A9638 963896386?+R I9638.9638 w9638 6B+F!9638 I-D I+G I9638 I A i6>+R A!i.!@J-!eK6L+P A9638 963896383+Q A K9638 963896383+R9638 V.!J 49638 -9638.!y9638T.9638 U.9638SV3+\.!J 49638 A 49638Y IY.Qh6\+b.|6^+b Ii3+c Iih Ihi AQ 49638V I A9638de I A9638 V+ Ij+ V+x9638. K ik. Fh-lm.!@n 9638.!J49638 .!J49638! A opqrs A  49638t W3+ W I 6+ !"#$%&' I)9638 9638" I()(-!M9638.9638 6+ I'49638# I&# I% A9638('&.9638 O%9638 V-9638 k6+ I$49638$ A9638 96389638%)&'$6+ I#9638.9638 w#9638 6+!9638 I#-# I"+U V+ I A9638%9638&. K i-g9638'.!J 49638(.!J 49638.!J 49638) A F I!- Ik> W3+ W I*  A!96389638 9638*%)&'$#"*> Ik= ~6k+ A!i.!@!-!e6+ A9638 96389638%) &'$#"3+ A 9638 96389638%) &'$#"3+9638 V.!J 49638) AQ49638+.X.!J 49638) A!x49638+-y.9638,-U ~j W3+ W Ij.!J 49638) AQ49638-9638. A9638.[.s+.X.!J 49638) A!x49638-. Oj6+ A!. 0496386+3+UU. L49638.!J49638. F9638/96380.7-k6+ Il-k 3+ Il= Il V+` Im+ V++,-..?V6+z. 0496386+3+VV. L49638.!J49638 A F96381963809638/.76+z I=. 0496386+3+WW. L49638.!J49638. F9638196380.76+96382. K i- F+-9638. 0496386+3+XX. L49638 A ) A 49638)3+'. 0496386)+ 3+ YY. L49638.!J) 49638- F9638/.7) )6)+'. 0496386)+3+ZZ. L49638.!J)49638!.Q)G6)+'96382. K i)- F+P-))9638. 0496386)+"3+$[[. L49638 A )))$ A 49638)%.|6)'+196383-  . K)))* I, R)+ ),, In.96384).3+>. 0 496386)1+43+6\\. L 49638. 0496386)7+:3+<]]. L49638 In A96385)6)< I.n.!J.496386.v)?+6)@+M. 0 496386)B+E3+G^^. L 49638-)G Io. Im W3+b. 0496386)M+P3+R__. L49638.!J)R49638. F9638196380.7)S)T6)U+u. 0496386)W+Z3+\``. L49638 AQ 49638V I- A9638)\)]96387. K i)_- F-)`)a.!@)b .!J96388496389-. 0 496386)f+i3+kaa. L 49638. 0496386)l+o3+qbb. L49638.!J)q49638 A )c)d)e)k)r A  49638)s I+ R9638:+.!J 49638 .9638;)v)w A! 49638 )x.!J 49638<. 0 496386){+~3+cc. L 49638 I.9638=)z)9638>. K i) A F-)).!@) . L49638? Ip A )) Im W3+b W3+\ W/ I0  I=.w09638@6)+.!J049638A I0.!M)3+.!J9638B49638C I/-)06+.w/9638D6)+12345678 I:9638 9638" I9:9-!M9638.9638 ))6)+ I849638# I7# I6 A9638987.9638 O69638 V-9638 k)6)+ I549638E A9638 963896386:7856)+ I49638.9638 w49638 6)+!9638 I4-)4 I3+ V+ I1 A9638%9638&. K i)-g9638F.!J 49638(.!J 49638.!J 49638) A F)))) I2-)) Ir> W3+ W I;  A!96389638 9638*6:78543;> Ir= ~)6r+ A!i.!@)2-!e)6)+ A9638 963896386:1785433+ A )9638 963896386:1785433+9638 V6+.!J9638B49638G0.))9638H-k)6)+<=>?@ABC IE9638 9638" IDED-!M9638.9638 ))6)+ IC49638# IB# IA A9638DCB.9638 OA9638 V-9638 k)6)+ I@49638I A9638 96389638AEBC@6)+ I?9638.9638 w?9638 6)+!9638 I?-)? I>+ V+ I< A9638%9638&. K i)-g9638J.!J 49638(.!J 49638.!J 49638) A F)))) I=-)) Is> W3+  W IF  A!96389638 9638*AEBC@?>F> Is= ~)6s+ A!i.!@) =-!e) 6) + A9638 96389638AE<BC@?>3+ A ) 9638 96389638AE<BC@?>3+9638 VGHIJKLMN IP9638 9638 IOPO-!M9638.9638 ))6) +L IN9638 IM# IL A9638ONM.9638 OL9638 V-9638 k)%6)&+L IK49638K A9638 96389638LPMNK6))+L IJ9638.9638 wJ9638 6),+0!9638 IJ-).J II+ V+>/. 0 496386)3+63+8dd. L 49638 IG A!y9638L)29638M)8 IH A i It> W3+C W IQ  A!96389638 9638*LPMNKJIQ> It= ~)16t+L A!i.!@)DH-!e)E6)F+J A9638 96389638LPGMNKJI3+K A )E9638 96389638LPGMNKJI3+L9638 V 06)M+U.!J49638N.Q)O+6)P+U>.!J 49638) A!x)S)R49638O.w/9638H6)U+X3+Z.9638P /-U)X Iq-U/ ~ Iuq Im W3+b W Im A!i.!@)b -!e)c6)d+n. 0 496386)f+i3+kee. L 49638.9638Q)k3+v9638Q. 0 496386)o+r3+tff. L 49638 A )c)n)t-k6)v+ V+. 0 496386)y+|3+~gg. L 49638-)~ W3+ W IR .9638RwR9638R9638S6)+-9638RR3+R.!J49638T.9638Rw))-9638R)6)+3+-9638RR ~)x. Om6)+ A!. Om6)+7u. Om6)+7p7o++?+/#9638U9638V,=/#9638U9638V,>/#9638U9638V,?/#9638U9638V,@/#9638U9638V,A/#9638U9638V,B/#9638U9638V,E/#9638U9638V,F/#9638U9638V,G/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,T/#5,U/#5,V/#5,/#9638U9638V,H/#9638U9638V,K/#9638U9638V,N/#9638U9638V,O/#9638U9638V,P/#9638U9638V,Q/#9638U9638V,R/#9638U9638V,T/#9638U9638V,U/#5,~,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,,&/#5,s,&/#5,t,&/#5,u,&/#5,v,&/#5,x,&/#5,y,&/#5,,&/#9638U9638V,W/#9638U9638V,X/#9638U9638V,Z/#9638U9638V,]/#9638U9638V,^/#9638U9638V,_/#9638U9638V,`/#9638U9638V,b/#9638U9638V,c/#9638U9638V,d/#9638U9638V,e/#9638U9638V,g/#9638U9638V,h/#9638U9638V,l/#9638U9638V,n/#9638U9638V,o/#9638U9638V,p/#9638U9638V,r/#9638U9638V,s/#9638U9638V,t/#9638U9638V,v/#9638U9638V,y/#9638U9638V,z/#9638U9638V,|/#9638U9638V,~/#9638U9638V,/#9638U9638V,/#9638U9638V,/#9638U9638V,/#9638U9638V,/#5,~,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,,[/#5,s,[/#5,t,[/#5,u,[/#5,v,[/#5,x,[/#5,y,[/#5,,[/#9638U9638V,/#9638U9638V,/#5,~,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,,t/#5,s,t/#5,t,t/#5,u,t/#5,v,t/#5,x,t/#5,y,t/#5,,t/#9638U9638V,/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#9638U9638V,/#9638U9638V,/#9638U9638V,/#9638U9638V,/#9638U9638V,/#9638U9638V,/#9638U9638V,/#59638W,/#59638W,/#59638W,,/#59638W,,?  !!!"###$$$$$$$$$$$$$$$%''''''''()****+,-.../001223347899999999:::::;<<<<<<<<<=>>>>>????????@@@@@@@@@@@AAAAAAAAAAAAABBBCCCCCCCCCCCCCCCDEEEEEEEEEFFFFFFFFFFFFGGGGGGGGGGGGGGGGGHHHHHHHHHHHHIIJJJJJJJKKKKKKKKKKKKLLLMMMMMMNNNNOOOOOOOOOPPPPPPPQQQQQQQQQQQQQQQQQQQQRRRRRSSSSSSSTTTTTTTTTTTTTTTUVVWWXYYZZZ\\\\\\\\]^____`abcccdeefgghhilmnnnnnnnnooooopqqqqqqqqqrssssssuuuuuuuuvwxxxxyz{|||}~~#connections#1proxysocket_typesocket_type_tlsreadtimeoutconnect_timeoutlogerrorslogtagcloseimmediatelykwreqiostreamshouldreusestart_timeIOTypeuserinfourltarget_urlmsgkwargslinefileidlogger_modulegroupstd_levellevelemsgkwargslinefileidlogger_modulegroupstd_levellevelerr#3#2InnerIOTyperroot_erremsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerretarget_urltarget_urltarget_urltarget_urltarget_urltarget_urltarget_urltarget_urltarget_urliotarget_urliotarget_urltarget_urliotarget_urlioioioioioconnect_timeout638Proxy-AuthorizationX.!J4.v96387?/#96389638,v? #self#x638 . L49638. 04963863. L49638. L49638. 0496386 3. L49638. L49638 A96387?/#96389638,i?#self##unused#iotarget_url638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638,<?#self#handler1connections638 HTTPS_PROXY https_proxyhttps HTTP_PROXY http_proxyhttp+(-963863-963867V3.Q96386 I AQ96389638G-e-k 6 73+(.Q96386+ I AQ96389638G-e-k6+73+(.Q96386+! I AQ96389638G-e-k6+!73+(.Q96386!+( I AQ96389638G-e-k$6%+(77V+(+(?/#9638 9638 ,"/#9638 9638 ,#/#9638 9638 ,#/#9638 9638 ,$/#9638 9638 ,%/#9638 9638 ,%/#9638 9638 ,&/#9638 9638 ,'/#9638 9638 ,'/#9638 9638 ,(/#9638 9638 ,)/#9638 9638 ,)/#9638 9638 ,*/#9638 9638 ,,? #self#schemehostp638 .,no_proxy6+!.963896386+!.!M963896389638. K i- F=- A 96389638 I-!P . O?-!Z 6 +! I. L. L9638.963896386+-!.{ I.!M3+ I. I.!P . O?-!Z6+!37?+!+!?/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,? #self#x638G+9638 I-!P. O?-!Z6+ I. L. L.96386 3.Q6 7>3 I.!P. O?-!Z6+37=++?/#96389638/#96389638/#96389638/#96389638?#self#hostx638.a.s9638.96387?/#96389638?#self#ssuffix6380:0:0:0:0:0:0:1'0000:0000:0000:0000:0000:0000:0000:0001::1 127.0.0.1 localhost.Q963867.Q963867.Q963867.Q96386 7 .Q96387 ?/#96389638? #self#host638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x8=%+)-691: #0('< ?4;> A$2*@&/. 35 "7,!638,  non-idempotentresponse streamed, request streamed, unrecoverable exception: : HTTP / +0 I A9638 I-9638.49638>.9638.b.w96386.!J49638 I A!y9638 96383+-9638-k 6 I9638 3+.!J49638 -9638 -k6+ I9638 3+ IG I I.!J49638 .!J49638 -9638 -k6+# I 96383+$ I G -9638-k%6&++.!J49638 I .!y(96383+, I G A 9638$,-9638-.7/+0+0?/#96389638,_/#96389638,`/#96389638,a/#96389638,b/#96389638,h?$#self#exrequnwrapped_exbuf638 H I.!J49638.!J49638 I AQ49638V.?V6 I3 IV A 7 ?/#96389638,Y/#96389638,Z/#96389638,[?&#self#sexreqcheckresp_bodyresp638a.!J49638-96387?/#96389638,V? #self#ex @638h.!J49638!9638.Q7?/#96389638,U? #self#ex 638h9638.!J49638.7?/#96389638,R? #self#ex638stream is closed or unusableb.!J49638.Q96387?/#96389638,Q? #self#ex638z-96386-9638-963877=?/#96389638,O? #self#ex638:7>?/#96389638,P?#self##unused#?/opt/julia/packages/HTTP/sJD5V/src/clientlayers/RetryRequest.jlڻ retrylayer(handler) -> handler Retry the request if it throws a recoverable exception. `Base.retry` and `Base.ExponentialBackOff` implement a randomised exponentially increasing delay is introduced between attempts to avoid exacerbating network congestion. By default, requests that have a retryable body, where the request wasn't written or is idempotent will be retried. If the request is made and a response is received with a status code of 403, 408, 409, 429, or 5xx, the request will be retried. `retries` controls the # of total retries that will be attempted. `retry_check` allows passing a custom retry check in the case where the default retry check _wouldn't_ retry, if `retry_check` returns true, then the request will be retried anyway. 6387+> I I9638. K i. F9638@-. 9638 I 9638 I = I . L49638 A i-! A7++?/#96389638,?G#self#reqretryretriesretry_delaysretry_checkretry_non_idempotent638Marking request body stream?/opt/julia/packages/HTTP/sJD5V/src/clientlayers/RetryRequest.jl8 X +s? I I- 9638   I A 9638. 04963863. L49638-k 63.Q6+ A!i.!@-!e6+. L49638- 7. L49638 A  7>.!J 49638 A!x49638.!J 49638 A!x 496386+&>.!J 49638 A!x$#49638 A  49638=.!J 49638.w'96386(+Z.!J9638 49638 .!J 49638-*+6,+Z I9638 9638 I-!M9638 .9638 896:+V I9638 I# I A9638.9638 O9638 V-9638 k?6@+V I49638 A9638 963896386C+V I9638.9638 w9638 6F+J!9638 I-H I+, I9638 I A i6>+V A!i.!@N-!eO6P+T A9638 963896383+U A O9638 963896383+V9638 V A  49638>.!J 49638-9638X I -9638- - -  -  A K[\]^_ I R`a b  9638. K ie. Fd-fg.!J49638. L49638 I A hij A!i.!@l-!em6n+r-  7p A m  7r+s+s?+"/#96389638,!/#96389638,#/#96389638,%/#96389638,&/#96389638,'/#96389638,(/#96389638,*/#96389638,+/#96389638,,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,T/#5,U/#5,V/#5,/#96389638,-/#96389638,./#96389638,0/#96389638,1/#96389638,K?  !!!!!!!!!!!!!!!!!""""""""#manageretries#1retryretriesretry_delaysretry_checkretry_non_idempotentkwreq#2retry_requestretryattemptreq_body_is_markedmsgkwargslinefileidlogger_modulegroupstd_levellevelretryretry638🚷 No Retry: Resetting request body stream: 🔄 Retry ?/opt/julia/packages/HTTP/sJD5V/src/clientlayers/RetryRequest.jl, +. L49638-!M.X. L49638.!x. L49638-!M. L49638.!J49638 A!x 49638-96386 . L49638 I'-9638 3 I'='6+ I(3+%. L49638-96386+#. L49638-9638-k6+ . L49638. L49638 I* A96383+! I*= I)*3+$ I)= I()(. L49638 A &49638 %. L49638-!M(. L49638 .Q)*6++1>. L49638.!J.49638 A!x/-49638. L49638 . 0149638 62+53+7$$. L149638 67+   I 9638 9638 I   -!M9638.9638 CD6E+l I 9638 I # I A9638   .9638 O 9638 V-9638 kJ6K+l I49638 A9638 96389638    6N+l I9638.9638 w9638 6Q+U!9638 I-S I+> V+^. L49638-9638W I A!y96389638X I A i I+> W3+c W I  A!96389638 9638    > I+= ~V6++l A!i.!@d-!ee6f+j A9638 96389638    3+k A e9638 96389638    3+l9638 V. L49638.!Jm49638-9638n. L49638. 0p49638 6q+t3+v%%. Lp49638 6v+ I9638 9638 I-!M9638.9638 6+ I9638 I# I A9638.9638 O9638 V-9638 k6+ I49638 A9638 963896386+ I9638.9638 w9638 6+!9638 I- I+A I9638 I A i6>+ A!i.!@-!e6+ A9638 963896383+ A 9638 963896383+9638 V. L49638.!J49638 -9638!. L49638.!J49638 -9638"3+ I"9638 9638 I!"!-!M9638.9638 6+ I 9638 I# I A9638! .9638 O9638 V-9638 k6+ I49638# A9638 96389638" 6+ I9638.9638 w9638 6+!9638 I- I+F V+. L49638.9638$ I.!y9638% I A i I,> W3+ W I#  A!96389638 9638" #> I,= ~6,+ A!i.!@-!e6+ A9638 96389638" 3+ A 9638 96389638" 3+9638 V. L49638 . 049638 6+3+&&. L49638 . F7++?+P/#9638&9638',4/#9638&9638',5/#9638&9638',6/#9638&9638',:/#9638&9638',;/#9638&9638',=/#9638&9638',>/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638&9638',?/#9638&9638',@/#9638&9638',A/#5,~,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,,!/#5,T,!/#5,U,!/#5,V,!/#5,,!/#9638&9638',B/#9638&9638',C/#9638&9638',F/#5,~,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,,8/#5,s,8/#5,t,8/#5,u,8/#5,v,8/#5,x,8/#5,y,8/#5,,8/#9638&9638',H?  """"""""#$%%%%&'()))*++,--../234444444566677799999999:;<<<<=>?@@@ABBCDDEEFIJJJKLLLLLMNNNNNNNNNOPPPPPPPP#self#sexmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelmsgkwargslinefileidlogger_modulegroupstd_levellevelerrretryreq_body_is_markedretry638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638,?#self#handler1manageretries63887=?/#96389638? #self#x638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x     C/opt/julia/packages/HTTP/sJD5V/src/clientlayers/ExceptionRequest.jlڻo exceptionlayer(handler) -> handler Throw a `StatusError` if the request returns an error response status. 638{. L49638VV A i-! A>=7?/#96389638?#self#stream638u +?  9638. K i A F-.!@. L49638 I A  6+-9638 6 + I .!J 49638.!J 49638 AQ49638.X.!J 49638 A!x49638.!J 49638.!J 49638.!J 49638 I A9638  -U 77 ++?/#9638 9638 /#9638 9638 /#9638 9638 /#9638 9638 /#9638 9638 /#9638 9638 /#9638 9638 ,?N#exceptions#1status_exceptiontimedoutlogerrorslogtagkwstreamereqres638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638?#self#handler1exceptions638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x     A/opt/julia/packages/HTTP/sJD5V/src/clientlayers/TimeoutRequest.jlڻv timeoutlayer(handler) -> handler Close the `HTTP.Stream` if no data has been received for `readtimeout` seconds. 638u. L49638V A i-! A=7?/#96389638?#self#stream638HTTP.TimeoutErrorA/opt/julia/packages/HTTP/sJD5V/src/clientlayers/TimeoutRequest.jl+g?.f69638. K i- F-.!@. L49638 A  7 V+9638- - - - . L49638-  A K . L49638 I R A96389638 W7 W I  .!J963849638.w6 +e.!J49638 I .!J"49638.!J 49638 AQ$49638 .X%.!J 49638 A!x'&49638 6+c    I9638 9638 I-!M9638 .9638 4566+b I49638 I# I A9638.9638 O9638 V-9638 k;6<+b I49638 A9638 963896386?+b I9638.9638 w9638 6B+F!9638 I-D I + V+T I A96389638. K iI-g9638.!J 49638.!J 49638.!J 49638 A FKLMN I -JO I> W3+Y W I  A!96389638 9638 > I= ~G6+b A!i.!@Z -!e[6\+` A9638 96389638  3+a A [9638 96389638  3+b9638 V.!J963849638 I -c- ~ 7e+g+g?+"/#96389638/#96389638/#96389638/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,/#96389638,!?  !!"""#timeouts#1readtimeoutlogerrorslogtagkwstream#2reqemsgkwargslinefileidlogger_modulegroupstd_levellevelerr6389638. K i. L49638. L49638 A F-. L49638.!@. L49638. L49638 A   7 ?/#96389638,?#self#timedout638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638?#self#handler1timeouts638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x%  !"  $#  @/opt/julia/packages/HTTP/sJD5V/src/clientlayers/CookieRequest.jlڻ cookielayer(handler) -> handler Check for host-appropriate cookies to include in the outgoing request from the `cookiejar` keyword argument (by default, a global cookiejar is used). Store "Set-Cookie" cookies from the response headers. 638~. L496389638 A i-! A>7?/#96389638? #self#req638Cookie+g?     .O>6 3+.w96386-e I-k3+ I=6+^ I.!J49638.!J963849638 I..w-k6+1 I -!P. O ?-!Z6+1 . L!.!l" I. L# I. L# A!l" I. L&. L!.9638.)* I .!P(. O ?-!Z-6.+13+!-e-k162+O.!J49638 I.963849638.vG66+F.!J49638.849638 69+F.!J963849638 I -;.!J49638 I .!M=49638 9638 -  . K?@ I RA  I .9638 C I.9638 G .!J49638.9638 .9638G.9638FH I R9638.K.!J49638 A!xML49638 A!i.!@O-!eP6Q+V. L49638 I-S3+X. L49638 I A PV I .!J963849638.!J 49638 AYZ[7 A!i.!@^-!e_6`+e. L49638-b7c. L49638 A _e7f+g+g?/#96389638/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,"/#96389638,#/#96389638,$/#96389638,%/#96389638,'/#96389638,(/#96389638,*/#96389638,+/#96389638,,/#96389638,/? #managecookies#1cookiescookiejarkwreq#3#2resfilteredpreviouslyincludedpreviouscookiesexistingcookiecookiestosendurlvaluename@ (08@ (08` (08@HIJKLPX 638P.!J496387?/#96389638,(? #self#x638v.!J49638. L49638.7-k7?/#96389638,$? #self#x638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638?#self#handler1managecookies638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x4.3$ 0 # ) ! "&(+'*,-/1%2638k.!x96387??/#96389638,[/#96389638,\? #self#x638.!l I. L I. L A!l I. L-9638.7?/#9638^? #self#vk638v I R9638.!_-!- d7?/#96389638,O? #self#h#4A/opt/julia/packages/HTTP/sJD5V/src/clientlayers/HeadersRequest.jlڻE headerslayer(handler) -> handler Sets default expected headers. A/opt/julia/packages/HTTP/sJD5V/src/clientlayers/HeadersRequest.jlڻ  setuseragent!(x::Union{String, Nothing}) Set the default User-Agent string to be used in each HTTP request. Can be manually overridden by passing an explicit `User-Agent` header. Setting `nothing` will prevent the default `User-Agent` header from being passed. HTTP.jl/1.10.3638|. L49638VV A i-! A>==7?/#96389638? #self#req638gzipAccept-Encoding!application/x-www-form-urlencodedPATCHPUTPOST0GETUpgradeTransfer-EncodingContent-Length User-Agent*/*AcceptHost:443https80http setting Content-Type header to: Content-TypeBasic #Adding Authorization: Basic header.A/opt/julia/packages/HTTP/sJD5V/src/clientlayers/HeadersRequest.jl Authorization'+?     I.!J 496386+@.!J 49638.!J 49638 I-9638 -e-k 6 +@.96389638-k6+@ I96389638 I-!M9638.96386+: I9638  I# I A9638 .9638O9638V-9638k#6$+: I49638 A96389638 9638 6'+: I9638.9638w96386*+.!9638 I-, I+ I9638 I A i6>+: A!i.!@2-!e364+8 A96389638 96383+9 A 396389638 96383+:9638V-9638.!y9638<.9638=.9638;>6+.96389638-kA6B+.!J 49638.wD9638-kE6F+.!J 49638-9638H6I+.!J 49638-9638K I -9638L.9638 .9638NO ! I#96389638 I"#"-!M9638.9638[\6]+ I!9638  I # I A9638 "! .9638O9638V-9638kb6c+ I49638 A96389638 9638 # !6f+ I9638.9638w96386i+m!9638 I-k I+ V+t I.!y9638 I A i I%> W3+y W I$  A!9638 96389638# !$> I%= ~n6%+ A!i.!@z-!e{6|+ A96389638 9638# !3+ A {96389638 9638# !3+9638V.!J 49638.!J49638-e6+3+.!J 49638.!J49638.Q9638 6+.!J 49638.!J49638 I&.Q9638!3+ I&=6&+3+.!J 49638.!J49638.Q9638"6+.!J 49638.!J49638 I'.Q9638#3+ I'=6'+.!J 49638 I .!J49638$3+.!J 49638.!J49638$.!J 49638.!J49638 I As9638%.9638& .9638'.9638(9638).9638'-!M9638*.?V6+-!M9638*.9638+.9638'.96389638,-k6+.96389638--k6+.96389638.-k6+.!J 49638 I -9638/.? V6+-y .9638,.96383+.!J 496380.Q963816+.w963826+.9638,96383.9638.96389638-k6+.!J 49638.w96386+.!J 496380 A F963849638596386.76+.!J 49638-96387.96383+.96389638-k6+.!J 49638 A KT96388i.w6+.!J 496380 A F963849638596386.76+.963896389.9638.OV6+3+6+.9638:9638;.9638'6+-9638< A! 496389638=. K i. F-.!@. L49638> I A  6+.!J 49638-9638< A! 496387 ++?+N/#9638?9638@/#9638?9638@/#9638?9638@/#9638?9638@/#9638?9638@,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,T/#5,U/#5,V/#5,/#9638?9638@,/#9638?9638@,/#9638?9638@,/#9638?9638@,/#9638?9638@, /#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#9638?9638@,#/#9638?9638@,&/#9638?9638@,(/#9638?9638@,*/#9638?9638@,+/#9638?9638@,,/#9638?9638@,-/#9638?9638@,0/#9638?9638@,3/#9638?9638@,4/#9638?9638@,5/#9638?9638@,6/#9638?9638@,7/#9638?9638@,:/#9638?9638@,</#9638?9638@,=/#9638?9638@,>/#9638?9638@,@/#9638?9638@,A/#9638?9638@,D/#9638?9638@,E/#9638?9638@,G/#9638?9638@,H/#9638?9638@,I/#9638?9638@,K?  !""""#$%&&&'(()**++,/0122222344444444456666666666666666666666667788888999:::;;;<<<<=========>>??@@@@AAAAABBBCCCCCCCCCCDDDDEEEEEEEEEEEFFFGGGGHHHIJJKKKKKKKLMMMN #defaultheaders#1iofunctiondecompressbasicauthdetect_content_typecanonicalize_headerskwreqreslhostheadersnuserinfoheadersmsgkwargslinefileidlogger_modulegroupstd_levellevelmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638? #self#handler1defaultheaders638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x 5 "*4 #)3+/0%!&$,-.'(2 1 638PATCHOPTIONSHEADDELETEPUTPOSTGET+.Q+363.Q+4673+.Q+/6796383+.Q496386 73+.?V6+- A F9638963896389638963896389638.76+73+.Q96386+779638++?/#96389638 ,^/#96389638 ,`/#96389638 ,a/#96389638 ,c/#96389638 ,d/#96389638 ,e/#96389638 ,f/#96389638 ,g/#96389638 ,h/#96389638 ,q/#96389638 ,s? 6#self#request_methodresponse_statusredirect_method638missing host in URL: Bmissing or unsupported scheme in URL (expected http(s) or ws(s)): wsswshttpshttpY.!J49638 A F9638963896389638.7-k6.!y9638--U.!J49638-e 6 .!y9638- -U 77??/#96389638 ,S/#96389638 ,T/#96389638 ,V/#96389638 ,W? #self#url` 638.Q67>3.9638637=-^-^.[  .!M .Q 9638.7 ?/#96389638,M/#96389638,N/#96389638,O?#self#subparent638.!J4y.OV67.!J4y.!J49638-9638.X7?/#96389638,B? #self#reqB/opt/julia/packages/HTTP/sJD5V/src/clientlayers/RedirectRequest.jlڻa redirectlayer(handler) -> handler Redirects the request in the case of 3xx response status. AuthorizationWww-AuthenticateCookie2Cookie638|. L49638VV A i-! A>>7?/#96389638? #self#req638 Unreachable!➡️ Redirect: B/opt/julia/packages/HTTP/sJD5V/src/clientlayers/RedirectRequest.jlGETLocationz +? I  -k63.Q6 A!i.!@ -!e 6 . L49638- 7. L49638 A  7>.!J49638 A!x49638 I 6>+   .!J49638-9638 A!i.!@!-!e"6#+(. L49638 I-%3+*. L49638 I A "( I.Q 6++.3+6-9638-k.6/+23+6.96389638 I2.Q2G64+77 I.!J49638.!J49638 I.96388.!J49638 .!J49638 I A9638 :;.Q 9638 6=+A I-!M3+B I.!J49638 I -9638.!J49638-4D9638. K iF.!J49638.!J49638 A FHIJK-GL I A M9638 CE 6+]9638-  - -  A KPQRS  I RTUV .!J49638.9638XY A!49638Z3+_-!M9638 A!49638] I96389638 I-!M9638.9638ij6k+ I9638 I# I A9638.9638O9638V-9638kp6q+ I49638 A9638963896386t+ I9638.9638w96386w+{!9638 I-y I+7 V+ I.!y9638  I A i I > W3+ W I  A!963896389638!> I = ~|6 + A!i.!@-!e6+ A963896389638"3+ A 963896389638"3+9638V I .X .Q 6+>.!J49638 A!x49638#3+6=+7?-!l9638$-!U7++?+./#9638%9638&/#9638%9638&/#9638%9638&/#9638%9638&/#9638%9638&,/#9638%9638&,/#9638%9638&,/#9638%9638&,/#9638%9638&,/#9638%9638&,!/#9638%9638&,"/#9638%9638&,#/#9638%9638&,$/#9638%9638&,%/#9638%9638&,'/#9638%9638&,(/#9638%9638&,5/#9638%9638&,7/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638%9638&,8/#9638%9638&,9/#9638%9638&,:/#9638%9638&,</#9638%9638&,=?  #$%&&&&&'((((((((()*++,,,-...#redirects#1redirectredirect_limitredirect_methodforwardheadersresponse_streamkwreqcount#2bodymethodurloldurllocationresmsgkwargslinefileidlogger_modulegroupstd_levellevelerrreq638Content-Length Content-TypeGETHost>+.!l I. L I. L A!l. L.Q963867=.796386 . L49638.!J 49638. L49638.!J 49638.9638 -k67=. L49638.Q96386+. F96389638 .76+7=7>++?/#9638 9638 ,*/#9638 9638 ,+/#9638 9638 ,,/#9638 9638 ,-/#9638 9638 ,./#9638 9638 ,//#9638 9638 ,1?#self#header638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638?#self#handler1redirects638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x- ') $* #%!,"(&+  A/opt/julia/packages/HTTP/sJD5V/src/clientlayers/MessageRequest.jlڻ messagelayer(handler) -> handler Construct a [`Request`](@ref) object from method, url, headers, and body. Hard-coded as the first layer in the request pipeline. 638. L49638V.9638-!M9638 A i-! A>7?/#96389638,?#self#methodurlheadersbody638F+^? -9638 .9638 9638. K i A F - I A 9638 I A9638 V+> I+ V+0.|6+%9638- - - - . L49638-  A K. L49638 I R9638. K i- F-.!J963849638 .!J9638 49638 I A  !"3+,9638 . K i%. F-&'.!@(. L49638 I A )* I  I W3+: W I .w9638 62+5 I.!J49638.w963865+8 I .!J49638 I- ~ I I W3+@ W I A9638.[@ I.sA+.!J49638 A!xCD49638 0 6F+[-9638 6H+[.!J 49638.!JJ49638.K496386L+[.!J 49638-9638N6O+V.!J 49638.!JQ49638.!MR49638 A! 49638S3+[.!J 49638.!J 49638.!JW49638.!MX49638.[VY. O6[+^ A!7+^+^?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,#/#96389638,&/#96389638,'/#96389638,)/#96389638,*/#96389638,,/#96389638,./#96389638,//#96389638,0/#96389638,1/#96389638,2/#96389638,4? }#makerequest#1copyheadersresponse_streamhttp_versionverbosekwmethodurlheadersbodyrespstart_timereq#2edur6389638. K i. L49638. L49638. F-. L49638.!@. L49638. L49638 A   7 ?/#96389638, ?#self#638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638,?#self#handler1makerequest638L-96387?/#96389638? #self#hch638P6-477?/#96389638?#self#headersch638L-!M96387?/#96389638?#self##unused#ch638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#xJ-Q(3Om @47~.MNA>}uz/]v,LigTd 'Y`;WP$1= H9r0Kbj5_lwsBE)2[ %UxX!&e#"8y6RaGS7 .!M.Q 9638[6+( I.96389638].OV6+ A FGG>7-^.Q6+ A FGG>73+".X.Q6+ 3+" A FGG>7 .[.{" I.9638# I I .X3+/.[.{( I.9638).963896386++/ A FGG>7- I-^.{.96380.96389638[1.?2V63+7 A FGG>75.{ .96387.96389638]8.?9V6:+> A FGG>7<.X.{> I.9638? A F=7A+B+B?+/#96389638,)/#96389638,,/#96389638,-/#96389638,./#96389638,1/#96389638,3/#96389638,4/#96389638,5/#96389638,7/#96389638,8/#96389638,9/#96389638,9/#96389638,>/#96389638,@/#96389638,A/#96389638,B/#96389638,D/#96389638,E/#96389638,F/#96389638,I/#96389638,J/#96389638,K/#96389638,M/#96389638,N/#96389638,Q/#96389638,R? &#self#hostportportlenhostzijk638s+D I.!J49638.QG6 A!49638> A!496387>-96386.v6 A!49638G= A!49638 7= A!49638> A!496387>.!M.Q9638.6+9638. K i. F- I A 9638-^.Q6+ 3+#.!M.Q 9638.6!+' A!49638G= A!49638$7=-9638-k'6(+. A!49638G= A!49638+7= I-9638-!.!M/0.Q19638.62+8 A!49638G= A!4963857=.v68+A.9638-k:6;+A A!49638G= A!49638>7= A!49638= A!49638B7>+D+D?+#/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,?  !""##self#jarchostdomain  638/-e63.!M.v9638/679638 I.96389638/.OV6 3.Q6 79638.{.!M7?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#pathi638]::* I.96389638.Q67=3.Q67>3.!M.Q 9638[6 .963896387 7=?/#96389638,/#96389638,/#96389638,/#96389638,?#self#hostcolons638+ I-96386-9638.!l I. L I. L A!l. L I. L A!l I. L 67G3-!.!M.Q9638.6+ I-9638-96386+-963877G++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#hosterrhost638Z A K9638 A7?/#96389638,~?#self#638Cookie expired: //opt/julia/packages/HTTP/sJD5V/src/cookiejar.jlhttpshttpQ+ I -9638-e 67?3.!J49638.v 96386 .!J49638.v 963867?.!J49638 I-9638.QG6+7?3+.!J49638 I-963896389638 96389638 I- I.!J4c-!c V+ I+ I R9638  .!J49638 I A9638 !" I -!P$. O ?-!Z&6'+ I . L+. L+.!J 49638.Q.G6/+23+6.!J 49638.!M2.v39638/64+7 A! 49638 A9638 67+:3+;3+ I-9638 .!J 49638._<6=+A3+3+.!J 49638.|A6B+M96389638.!J 49638-EF.XDG A! 49638H> A! 49638J3+.!J 49638-9638.QMN6O+U A! 496389638= A! 49638R3+.!J 49638._U6V+ I96389638 I-!M9638.9638bc6d+ I9638 I# I A9638.9638O9638V-9638ki6j+ I49638 A9638963896386m+ I9638.9638w96386p+t!9638 I-r I+ V+|.!J 49638! I.!y9638"v I A i I> W3+ W I  A!963896389638#> I= ~u6+ A!i.!@-!e6+ A963896389638$3+ A 963896389638$3+9638V3+> A! 49638. 6+ I.!M .!J49638% A! 49638%3+ A! 49638% A! 49638& A!x  3+.9638'  I .!P$-. O ?-!Z6+3+) W3+ W I-!9638(. O6+ A!7?++?+B/#9638)9638*,t/#9638)9638*,u/#9638)9638*,v/#9638)9638*,w/#9638)9638*,y/#9638)9638*,z/#9638)9638*,{/#9638)9638*,|/#9638)9638*,}/#59638+,/#59638+, /#59638+, /#59638+, /#59638*,~/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638*,/#59638+, /#9638)9638*,?  !!!!"#$%%%&''())**+.//0111112333333333456677899:;<=?@@@@@ AAAAB#self#jarurlheaderstempnowdefPathhostcookies#10entriescoldcidmsgkwargslinefileidlogger_modulegroupstd_levellevelerr  ` 638+.!J49638-^.!J49638-^.v6.!J49638-^.!J49638-^ .| 7 .!J49638.!J49638.v 6+.!J49638.!J49638._7.!J49638.!J49638._7++?/#96389638,a/#96389638,b/#96389638,d/#96389638,e/#96389638,g? #self#xy638 to Including cookie in request: Deleting expired cookie: //opt/julia/packages/HTTP/sJD5V/src/cookiejar.jl/httpshttp1+. K9638 I-!M9638.!J49638.v96386.!J49638.v 96386 I*. w*6 3.!N* I*. 7*.!J49638 I-9638.QG6+ I+. w+6+3+.!N+ I+. 7+3+ I.!J4c-!c V+ I,+     .!J49638.*-k+6,+3 I- I, W3+3+3.!J49638 I.!M3.!J49638 I.Q59638 I .!J49638.Q G68+; I 9638 I = I -!M9638 I -!P=. O ?-!Z?6@+ . LB.!lC I. LD I. LD A!lC I. LG. LB.!J49638 6J+.!J49638 -9638 .vLM6N+.!J49638 ._P6Q+ I9638 9638 I-!M9638.9638 ]^6_+ I9638 I# I A9638.9638 O9638 V-9638 kd6e+ I49638 A9638 963896386h+ I9638.9638 w9638 6k+o!9638 I-m I+Q V+w.!J49638 I.!y9638q I A i I.> W3+| W I  A!96389638 9638> I.= ~p6.+ A!i.!@}-!e~6+ A9638 963896383+ A ~9638 963896383+9638 V. 3+ A9638 -k6+3+ A!49638 !"#$% I'9638 9638 I&'&-!M9638.9638 6+ I%9638 I$# I# A9638&%$.9638 O#9638 V-9638 k6+ I"49638 A9638 96389638#'$%"6+ I!9638.9638 w!9638 6+!9638 I!-! I +Y V+.!J49638.!J49638 I A!y96389638 I A i I/> W3+ W I(  A!96389638 9638#'$%"! (> I/= ~6/+ A!i.!@-!e6+ A9638 96389638#'$%"! 3+ A 9638 96389638#'$%"! 3+9638 V. I .!P=I. O ?-!Z6+3+B I -!P. O ?-!Z6+ I). L. L-9638).9638  I .!P. O ?-!Z6+3+ W3+ W I,-!9638!. O,6+ A!. O,6+ I0-. w06+3+.!N0 I0. 709638". K i I R9638#- F- A 9638$ I1. w16+3+.!N1 I1. 71++?+Q/#9638%9638&,?/#9638%9638&,@/#9638%9638&,A/#9638%9638&,C/#9638%9638&,D/#9638%9638&,E/#59638',/#59638', /#59638', /#59638', /#59638&,F/#59638&,G/#59638&,H/#59638&,I/#59638&,J/#59638&,K/#59638&,M/#59638&,N/#59638&,O/#59638&,P/#59638&,Q/#5,~,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,,/#5,s,/#5,t,/#5,u,/#5,v,/#5,x,/#5,y,/#5,,/#59638&,R/#59638&,S/#59638&,U/#59638&,V/#59638&,X/#59638&,Y/#5,~,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,,2/#5,s,2/#5,t,2/#5,u,2/#5,v,2/#5,x,2/#5,y,2/#5,,2/#59638&,Z/#59638&,[/#59638&,\/#59638&,]/#59638&,^/#59638', /#9638%9638&,`/#9638%9638&,i?  !!""#&''()))))*+++++++++,-.///0133333333456666789:::;<<=>>??@CDDDEFFFFFGHHHHHHHHHIJKKKKKLLLLLLLLMMMNNNNN OOOOOOOOOOOPPPPPPPQQQQQQ#self#jarurlnow#8temphostcookiesexpiredmodifiedpathhttpsentrieseidmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrc  ` 638H9638963896389638- A7?/#96389638,??#self#jarurl  ` 638Q+!.!J49638.Q67>3.!J49638.96386+!.!J49638-^ .| 6 .!J49638-! .!M .Q9638/67>3+!-^.!J49638-^.X.6+!.!J49638-^.X.!M.Q9638/6+!7>7=+!+!?/#96389638,*/#96389638,+/#96389638,,/#96389638,-/#96389638,./#96389638,//#96389638,2?#self#cookierequestpath638+-^-^.|6+-^-^.[.!M.Q9638.6 -^-^.[  .X -!.{.!M.Q77=7=++?/#96389638,%?#self#ssuffix638.!J49638.Q67>3.!J49638-k6.!J49638.9638 7 7=?/#96389638,/#96389638, ?#self#cookiehost638.96386.9638667.!J49638-k77=7=?/#96389638,?#self#cookiehttpshostpath638r. L49638.!J49638-96387?/#96389638?#self#638?.|963867>9638-.X.!M7?/#96389638,? #self#c638Y.963896387?/#96389638,? #self#v638B-96387?/#9638^? #self#b638+ I9638 I R9638-9638.!_-!.9638 I--^.Q 6 73.96389638 63.96389638,6+ Ay9638"9638"77++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#v#4v638.9638 9638-.9638.9638 9638-.96387?/#96389638,? #self#n638T--96387?/#96389638,? #self#n638  +e I-^.Q67=3-^.| +6 7=3.!M.Q9638.6+-!.{ I .!M3+ I  I I9638. I= I I-!P. O?-!Z6 +^ I. L". L".f9638a6%+) I .f9638z3+* I =6 +,3+2.f9638A6,+0 I .f9638Z3+1 I =6 +5 I> I.X3+X.f9638065+9 I .f963893+: I =6 += I.X3+X.Q9638-6=+E.Q9638.6?+C7=3+C I.X3+X.Q9638.6E+W.Q9638.6G+J3+L.Q9638-6J+N7=3+N.|+?6N+Q3+S.Q6Q+U7=3+U I3+X7= I I.!P$. O?-!ZZ6[+^3+".Q9638-6^+a3+c.|+?6a+e7=3+e7+e+e?+/#96389638,y/#96389638,z/#96389638,{/#96389638,|/#96389638,}/#96389638,~/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? "#self#spartlenoklastcs638:-963867>3-96386.96389638-k67>337=?/#96389638,p/#96389638,q/#96389638,r? #self#v638f96389638-.+A7?/#96389638,k? #self#dt638Cookie +W I-!M9638.96389638 I-!P. O?-!Z6+W I. L. L-96389638. K i - F=-  A 9638 9638; I-!P. O?-!Z6+R     I . L. L I -9638 -^ .f6+"3+M3+"-9638= I .9638" .? V6$+2 .[ .{'.!M&( .X -! .{+,.!M*- I ) I .3+4 I  I G-9638 -k465+93+M3+9.vG69+@.v 6;+?3+M3+?3+@.9638  >.!l@ I . LA I. LA A!l@ I . LD-k 6F+J3+M3+J A9638  .JK I.!P. O?-!ZN6O+R3 I.!P . O?-!ZS6T+W37+W+W?/#9638 9638 ,Q/#9638 9638 ,R/#9638 9638 ,S/#9638 9638 ,T/#9638 9638 ,U/#9638 9638 ,V/#9638 9638 ,W/#9638 9638 ,X/#9638 9638 ,Z/#9638 9638 ,\/#9638 9638 ,]/#9638 9638 ,^/#9638 9638 ,_/#9638 9638 ,`/#9638 9638 ,a/#9638 9638 ,b/#9638 9638 ,c? 2#self#hfilterresultlinepartokvalnamej638EH.G7?/#96389638,Q? #self#h638b-9638.96387?/#96389638,f? #self#hf638b.!J49638.9638G7?/#96389638,K? #self#r638a.!J49638-96387?/#96389638,J? #self#r638  V!9638. W7> W I .w6 ~7=3- ~7?/#96389638,:/#96389638,;/#96389638,</#96389638,>/#96389638,??#self#hoste638pathexpiresmax-agedomainhttponlysecurenonestrictlaxsamesite Set-Cookie+ I-!M9638.96389638 I-!P. O?-!Z6+      I. L. L-96389638. K i- F=- I A 96389638;-^.Q6+.!M.QG6+3+.!M I -9638-9638= I .9638! .? V6#+/ .[ .{&.9638%' .X .9638)* I ( I +3+1 I  I G-9638  -k162+63+3+6.9638  >.!l6 I . L7 I. L7 A!l6 I . L:-k 6<+@3+3+@ I A9638  -^.{A I-!PB. O?-!ZD6E+ I. LJ. LJ.!M I -9638M-e 6O+S3+3+S-9638= I .9638S .? V6U+a .[ .{X.9638WY .X .9638[\ IZ I ]3+c I I G-9638 -kc6d+h3+3+h I-9638 .9638  =.!li I . Lj I. Lj A!li I . Lm-k 6o+t.!J49638 .q 3+.Q96386t+-9638  -kv6w+{ A!4963896383+ I -9638  .Q 96386|+ A!4963896383+.Q 96386+ A!4963896383+.Q 96386+ A!4963896383+ A!4963896383+.Q96386+> A!496383+.Q96386+> A!496383+.Q96386+ A!49638 3+.Q96386+ V+ I. .!M .Q963806+ W3+3+.+ A!49638 W3+ W ~3+ ~3+.Q96386+ A!49638  V+9638!9638" .9638# A!49638$ W3+ W V+9638!9638" .9638% A!49638$ W3+ W ~3+ ~ ~3+.Q9638&6+ A!49638' 3+.!J49638 .!M. I.!PBL. O?-!Z6+3+G. I.!P. O?-!Z6+37++?+A/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638), /#9638(9638), /#9638(9638), /#9638(9638), /#9638(9638), /#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),/#9638(9638),!/#9638(9638),"/#9638(9638),#/#9638(9638),$/#9638(9638),&/#9638(9638),'/#9638(9638),)/#9638(9638),,/#9638(9638),-/#9638(9638),//#9638(9638),1/#9638(9638),2/#9638(9638),3/#9638(9638),4?  !!"##$%%&'(())**++,,-../011111222223334456777777789999999::::;;<===>>>>>?@@@@@AJ#self#hresultlinecokvalnamejpartpartsilowerattrattrsecs638^-9638-96387?/#96389638,7? #self#h  ( 0@ HX `p x  P GMT,  P GMT,   @ 638 G\MTo96389638.y d9638-7?/#96389638,?#self##unused#638l.QG67=.963896387?/#96389638,? #self#raw638[+) I6-^.|6.!M.Q9638"6-!.!M  .Q 9638"6 -!.[.{ I.!M- I-!P. O?-!Z6+( I. L. L.!M-9638-k6+#. FG=7 3+# I.!P. O?-!Z$6%+(3+. F>7(+)+)?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?##self#rawallowdoublequoteiraw638.f9638 6 I._96383 I=6.v9638"6.v9638;6 .v9638\7 7=7=7=?/#96389638,? #self#b638.f9638 6 I._96383 I=6.v9638;77=?/#96389638,? #self#b638 Set-Cookie-96389638.9638=-9638..96387?/#96389638,/#96389638,? #self#rc638; Cookie I-9638 I A96389638V.?V6 A!y9638.9638.96383-96389638-9638.  .9638 7?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#rccheadcstr638; SameSite=None; SameSite=Strict; SameSite=Lax; Secure ; HttpOnly ; Max-Age=0 ; Max-Age= GMT ; Expires= ; Domain=; Path=J+].!J49638 I-9638-9638-k67G3 I A9638-9638.!J4-9638 A[  9638= -k6+[.!J49638-^.|6+.!J49638-9638 A[9638 3+.!J49638 -^.|6+..!J49638 -9638 6+-.!J49638 .!M".Q#9638.6$+).!J49638 I.9638 &3+* I.!J49638  A[!9638 *3+-3+..!J49638-9638.6/+896389638.!J4963896389638.234 A[19638596383+8.!J49638.|869+@.!J49638-y< A[;9638=3+@.!J49638._@6A+E.[96383+E.!J496386E+I.[96383+I.!J496386I+M.[96383+M.!J49638.QM96386N+R.[96383+[.!J49638.QR96386S+W.[9638 3+[.!J49638.QW9638!6X+[.[9638"-9638#-[7\+]+]?/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,/#9638$9638%,? #self#cisrequestionm638EH.>7?/#96389638,? #self#c638; ; +1 I A9638-e-k6+.[-e-k6 +-!9638 .9638 .9638 96386 +-!.!M.Q9638;6+.[9638 3+3+.[9638 I-^-9638 I-!P. O?-!Z6+/. L.!l I . L I. L A!l I . L". L.9638 .Q  Az'G9638 A[%&( I.!P$. O?-!Z+6,+/3+-9638-/70+1+1?/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,? 8#self#cookiestringcookiesisrequestleniocookiei638KH A>7?/#96389638,?#self#cookiestringcookies638;.!J49638.!J49638.!J49638 A!y963896387?/#96389638,o? #self#c638L+?--96389638-96389638-96389638-9638--!M A9638GGG ====   A!i.!@-!e6-9638 7 A 9638 7++?/#96389638,g?#Cookie#3argsnamevalueraw638? A9638GGG A!i.!@-!e6-96387 A 96387 ?/#96389638,e?#Cookie#2kwargs638+? I-!P. O?-!Z6+. L.!l I. L I. L A!l I. L . L.9638.N A I.!P. O?-!Z6+37++?/#96389638,`/#96389638,a/#96389638,b/#96389638,c?#Cookie#1kwargscookievk//opt/julia/packages/HTTP/sJD5V/src/cookiejar.jlڻ3 Cookies.setcookies!(jar::CookieJar, url::URI, headers::Headers) Identify, "Set-Cookie" response headers from `headers`, parse the `Cookie`s, and store valid entries in the cookie `jar` according to the canonical host in `url`. Cookies can be retrieved from the `jar` via [`Cookies.getcookies!`](@ref).   ` -/opt/julia/packages/HTTP/sJD5V/src/cookies.jlڻ= Cookies.addcookie!(r::Union{HTTP.Request, HTTP.Response}, c::Cookie) Convenience function for adding a single cookie to a request or response object. For requests, the cookie will be stringified and concatenated to any existing "Cookie" header. For responses, an additional "Set-Cookie" header will be appended. -/opt/julia/packages/HTTP/sJD5V/src/cookies.jlڻ9 stringify(cookie::Cookie, isrequest=true) Generate the string representation of a cookie. By default, `isrequest=true`, and only the `name=value` pair will be included in the cookie string. For `isrequest=false`, the other cookie attributes will be included, `;`-separated, for use in a "Set-Cookie" header. -/opt/julia/packages/HTTP/sJD5V/src/cookies.jlڻ HTTP.cookies(r::Union{Request, Response}) -> Vector{Cookie} Return a list of cookies, if any, parsed from the request "Cookie" or response "Set-Cookie" headers. -/opt/julia/packages/HTTP/sJD5V/src/cookies.jlڻ Cookie() Cookie(; kwargs...) Cookie(name, value; kwargs...) A `Cookie` represents an HTTP cookie as sent in the `"Set-Cookie"` header of an HTTP response or the Cookie header of an HTTP request. Supported fields (which can be set using keyword arguments) include: * `name::String`: name of the cookie * `value::String`: value of the cookie * `path::String`: applicable path for the cookie * `domain::String`: applicable domain for the cookie * `expires::Dates.DateTime`: when the cookie should expire * `maxage::Int`: `maxage == 0` means no max age, `maxage < 0` means delete cookie now, `maxage > 0` means the # of seconds until expiration * `secure::Bool`: secure cookie attribute * `httponly::Bool`: httponly cookie attribute * `hostonly::Bool`: hostonly cookie attribute * `samesite::Bool`: SameSite cookie attribute See [IETF RFC 6265](http://tools.ietf.org/html/rfc6265) for details. The string representation of a cookie is generated by calling [`stringify(cookie; isrequest=true)`](@ref), where `isrequest=true` will only include the `name=value` pair for requests, and if `false`, will generate the `"Set-Cookie"` representation for a response header. A `Vector{Cookie}` can be retrieved from a `Request`/`Response` object by calling [`Cookies.cookies(r)`](@ref). A `Cookie` can be added to a `Request`/`Response` object by calling [`Cookies.addcookie!(r, cookie)`](@ref). //opt/julia/packages/HTTP/sJD5V/src/cookiejar.jlڻ Cookies.getcookies!(jar::CookieJar, url::URI) Retrieve valid `Cookie`s from the `CookieJar` according to the provided `url`. Cookies will be returned as a `Vector{Cookie}`. Only cookies for `http` or `https` scheme in the url will be returned. Cookies will be checked according to the canonical host of the url and any cookie max age or expiration will be accounted for. Expired cookies will not be returned and will be removed from the cookie jar.   `   ` //opt/julia/packages/HTTP/sJD5V/src/cookiejar.jlڻ> CookieJar() A thread-safe object for storing cookies returned in "Set-Cookie" response headers. Keyed by appropriate host from the original request made. Can be created manually and passed like `HTTP.get(url; cookiejar=mycookiejar)` to avoid using the default global `CookieJar`. The 2 main functions for interacting with a `CookieJar` are [`Cookies.getcookies!`](@ref), which returns a `Vector{Cookie}` for a given url (and will remove expired cookies from the jar), and [`Cookies.setcookies!`](@ref), which will store "Set-Cookie" response headers in the cookie jar. T A !963887@@`?'//#9638,?638N A !96387?/#9638,? #self#x638R A !96387?/#9638,?#self#mapexprx638Z. 963896387?/#96389638,? #self#x E0DQ'yLv=g>%UJn| 8pMsZ^`of+W@_-P?T }2 XVOb$rB~ *Ie(a ,F<6  4Sultdz\{15mi:w.jAk"GYqRKc!7H3/;Nx#C] h9)[&638+9638. L49638- . K. L49638 I R A!i. L49638.!@ -!e 6 9638. L49638. L49638. L49638 A 79638. L49638. L49638. L49638 A  7++?/#96389638,^? #self##47638w9638- I.!J49638. L49638.!J49638. F.9638-96386 !9638- 37??/#96389638,_/#96389638,`/#96389638,a/#96389638,b/#96389638,c/#96389638,d?#self#httpsocket638 +? A K963896389638 A K96389638. K I-9638- - - - -  A K    I R  I -96389638= A! 49638.96389638 496386=+.96389638 9638  -96389638   -9638  I . w 6+3+.!N I . 7 ++?/#9638 9638,]/#9638 9638,^/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#59638,/#9638 9638,f? 9#openraw#45kwmethodurlheaderssocketready#46task638l A i-! A96387?/#96389638,\?#self#methodurlheaders638^H-!M9638 A7?/#96389638,\?#self#methodurl638?9638-y9638. K i- F-.!@ A 9638V I . w6 3.!N I. 7?/#96389638,C?##open#44kwfmethodurlheaders638N-96387?/#96389638,,?#self#url#unused#638-96389638. K i- F- A 96387?/#96389638,+?#self#urlquery638DELETE? A!i.!@-!e69638- F9638 A }!P7 A F96389638 A }!P  7 ?/#96389638,)?#delete#43kwa638v9638 A i-!. F A }!P7?/#96389638,)? #self#a638HEAD? A!i.!@-!e6.963896387 A 963896387?/#96389638,"?#head#42kwu638d A i-! A96387?/#96389638,"? #self#u638PATCH? A!i.!@-!e69638- F9638 A }!P7 A F96389638 A }!P  7 ?/#96389638,?#patch#41kwa638v9638 A i-!. F A }!P7?/#96389638,? #self#a638POST? A!i.!@-!e69638- F9638 A }!P7 A F96389638 A }!P  7 ?/#96389638,?#post#40kwa638v9638 A i-!. F A }!P7?/#96389638,? #self#a638PUT? A!i.!@-!e69638- F9638 A }!P7 A F96389638 A }!P  7 ?/#96389638, ?#put#39kwa638v9638 A i-!. F A }!P7?/#96389638, ? #self#a638GET? A!i.!@-!e69638- F9638 A }!P7 A F96389638 A }!P  7 ?/#96389638,?#get#38kwa638m9638 A i-!. F A }!P7?/#Q9638,? #self#a638DELETEHEADPATCHPOSTPUTGETv+(? 49638 49638 A 49638 A 4I 49638 49638 A 49638 A 4I 49638 49638 A 49638 A 4I  49638 49638 A 49638 A 4I 49638 49638 A 49638 A 4I 49638 49638 A 49638 A 4I 49638 49638 A 49638 A 4I 49638 49638 49638 49638 A 4A!49638 A 4A "4963849638496384963849638 A 49638# A 49638$ A 49638  %-&7'+(+(?/#96389638,?8#self#__source____module__requestlayersstreamlayers638\H? A! A7?/#96389638,?+#self#__source____module__requestlayers638_?!9638--7?/#96389638,?"#self#__source____module__expr638EH+?9638-y.9638  A!i.!@-!e6 A I  . w 6 3.!N I . 7 A  I. w6+3+.!N I. 7++?/#96389638,?<#request#37headersbodyquerykwstackmethodurlhbq638}V A i-! A9638=7?/#96389638,9?#self#methodurlhb638ZH A96387?/#96389638,9?#self#methodurlh638XH AV96387?/#96389638,9?#self#methodurl638 A i-! A96387?/#96389638,?#self#stackmethodurlhbq638XH AV7?/#96389638,?#self#stackmethodurlhb638`H A9638V7?/#96389638,?#self#stackmethodurlh638^H AV9638V7?/#96389638,?#self#stackmethodurl638aH. L49638--7?/#96389638,? #self#xy638aH. L49638--7?/#96389638,? #self#xy638aH. L49638--7?/#96389638,? #self#xy638aH. L49638--7?/#96389638,? #self#xy638aH. L49638--7?/#96389638,? #self#xy638aH. L49638--7?/#96389638,? #self#xy638PH<< A7?/#96389638,?#self#observelayers638MH<< A=7?/#96389638,?#self#638%X+}     6 I96383 Im I.wi6+$.46+ I.!J43+ I< I.46+! I.!J43+" I< I3+& I I<9638- . K&' I R( -96389638. K i,- F+--. I A /9638*9638- . K12 I R3 9638. K i6- F-78 I A 9963859638-e-k;6<+H9638- . K>? I R@9638. K iC- F-DE I A F9638B.wi6H+W.46J+N I.!J43+O I< I.46P+T I.!J43+U I< I 3+Y I I <9638- . KYZ I R[9638. K i^-9638 -`- Fa-_b I A c9638]9638 - . Kef I Rg9638. K ij- F -kl I A m9638i9638 -e -ko6p+|9638 - . Krs I Rt9638. K iw- F -xy I A z9638v -9638  7|+}+}?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? #self#observelayersrequestlayersstreamlayers#30#29#28#27#26#25layers4layers3outer_request_layersinner_request_layerslayers2layersouter_stream_layersinner_stream_layersobs638OH< A7?/#96389638,?##self#observelayersrequestlayers638?6 I96383 I9638-96387?/#96389638,?#popfirstlayer!#24request638M.9638>7?/#96389638,?#self#638?6 I96383 I9638-96387?/#96389638,?#poplayer!#23request638M.9638>7?/#96389638,?#self#638?6 I96383 I9638.96387?/#96389638,?$#pushfirstlayer!#22requestlayer638S A9638>7?/#96389638,? #self#layer638?6 I96383 I9638.7?/#96389638,?#pushlayer!#21requestlayer638S A9638>7?/#96389638,? #self#layer638] +?96389638- A!i.!@-!e6 A9638  I  . w 6 3.!N I . 7 A 9638  I . w 6+3+.!N I . 7 ++?/#96389638,;?B#request#20headersbodyqueryobservelayerskwmethodurlhbNJAM:+<294X"% ;T W\$[R,6B@FSYK= 7VGZ&-1CUQ5!(PE 'DL#0)I*>3?O 8/H. 638 .!J49638.0496386.!J963849638 I A3.!J963849638 I A I-96389638.i -96389638.i -96389638.i-96389638.i7??/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,? #self#nt6389boundary delimiter must not be greater than 70 characters#multipart/form-data; boundary=(.*)$ Content-Type+T. K9638 A K.!M9638 I.96389638.OV6 IV. w6 3.!N I.  73 I.!M-^.|+F6+-I96383+-9638.9638 I. w6+3+.!N I. 7++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?"#self#msgboundary_delimiterm638 +3. K9638 I-!M9638-9638 I.9638-^.|63 I . w 6 3.!N I . 7 -^.[.{ I-!P. O?-!Z6+- I. L. L.!M.!M.X.X.!M.!M .[!.{" I.#-9638.%& I.!P. O?-!Z)6*+-3+ I . w 6.+13+3.!N I . 17 +3+3?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?0#self#bodyboundaryidxsmultipartsichunk638 text/plainfilenamename8Content disposition is not specified dropping the chunk.4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jl +  -9638.!l I. L I. L A!l I. L . .[.X. I -9638.X-.{ I . I .96389638963896389638 . -k6+T I96389638 I-!M9638 .9638'(6)+R I49638 I# I A9638 .9638O9638V-9638k.6/+R I49638 A96389638 963862+R I9638.9638w963865+9!9638 I-7 I+ V+D I96389638. K i<-- F> I-=? I> W3+I W I  A!9638 96389638> I= ~:6+R A!i.!@J-!eK6L+P A96389638 96383+Q A K96389638 96383+R9638V7V96389638 I ATU I .963896389638 I.963896389638 IV IV-e -k[6\+96389638.`a 6b+v96389638 I Ade 96389638 I Agh .Q96386j+n I3+r.Q96386n+r I3+r96389638 I .rs 3+96389638 .vw 6x+~96389638 I .z{ 3+3+3+[.OV6+7?3+ I.96389638963896389638. 6+96389638 I A 3+ I9638 I-9638   A9638!G7++?+5/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,/#9638"9638#,?  !"#$$$%%%%%%&&&'''(()**+---....///01222344444444455555#self#chunkcontenttypere_ctfilenamenamere_pairre_flagcontent_dispositionrecontentheaderend_indexstartIndexmsgkwargslinefileidlogger_modulegroupstd_levellevelerrvaluekey638(?i)Content-Type: (\S*[^;\s])96389638 I-963896389638-7?/#96389638,/#96389638,? #self#r638=^ [ \t]*([!#$%&'*+\-.^_`|~[:alnum:]]+)[ \t]*=[ \t]*"(.*?)";? 96389638 I-963896389638-7?/#96389638,/#96389638,? #self#r638)^ [ \t]*([!#$%&'*+\-.^_`|~[:alnum:]]+);? 96389638 I-963896389638-7?/#96389638,/#96389638,? #self#r6389^[Cc]ontent-[Dd]isposition:[ \t]*form-data;[ \t]*(.*)\r\n96389638 I-963896389638-7?/#96389638,}/#96389638,~? #self#r6388no delimiter found separating header from multipart bodyq+-^9638-^.|67V3-^-^9638.[  I.X I I-^9638.f6+ A963896386+. F73+ I.X I.X3-I96387++?/#96389638,n/#96389638,p/#96389638,q/#96389638,r/#96389638,s/#96389638,t/#96389638,u/#96389638,v/#96389638,w/#96389638,x? #self#bytesend_indexil6388 +? I  A K I-!M6>+9638. K i- F - A  9638.!l I . L I. L A!l  I . L I. L A!l  I. L. F .6 +3+3+ I .X37++?/#96389638,Z/#96389638,[/#96389638,\/#96389638,]/#96389638,^/#96389638,_/#96389638,`/#96389638,a?d#find_multipart_boundaries#2startbytesboundaryidxsend_indexiis_terminating_delimiterstart638W A96387?/#96389638,Y?#self#bytesboundary638boundary delimiter not found7boundary delimiter found, but did not end with new line<boundary delimiter found, but it was not the start of a line +c? I-^ I AX-^.f6+b .!M.Q 96386 +_.X.!M.Q96386+_.X A96386+_.|6+(.Q6+3+%.[.!M.v96386+!3+%.[.!M!.v"96386#+'-I96383+' I.[-^.[)._(*6++.3+/-I9638.X.!M/.Q0963861+7.X.!M3 I .Q496383+8 I = I  6 +< I.X3+<-^._<=6>+G.X.!M@. F96389638.7AB6C+G I.X3+<-^.[H._GI6J+W.X.!ML.QM96386N+T.X.!MP I .QQ96383+U I = I  3+X I = I -k6Y+\-I9638 I.X A F 7] I.X I.X3-I96387b+c+c?+/#9638 9638 ,(/#9638 9638 ,)/#9638 9638 ,*/#9638 9638 ,+/#9638 9638 ,-/#9638 9638 ,./#9638 9638 ,1/#9638 9638 ,5/#9638 9638 ,7/#9638 9638 ,8/#9638 9638 ,;/#9638 9638 ,</#9638 9638 ,=/#9638 9638 ,?/#9638 9638 ,B/#9638 9638 ,C/#9638 9638 ,F/#9638 9638 ,H/#9638 9638 ,K/#9638 9638 ,L/#9638 9638 ,M/#9638 9638 ,O? m#find_multipart_boundary#1startbytesboundaryDelimiterend_indexinewlineEndis_terminating_delimiter638W A96387?/#96389638, ?#self#bytesboundaryDelimiter4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jlڻ find_multipart_boundaries(bytes, boundary; start=1) Find the start and end indexes of all the parts of the multipart object. Ultimately this method is looking for the data between the boundary delimiters in the byte array. A vector containing all the start/end pairs is returned. 4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jlڻ]compare byte buffer `a` from index `i` to index `j` with `b` and check if they are byte-equal4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jlڻa parse_multipart_form(req::Request)::Vector{Multipart} Parse the full mutipart form submission from the client returning and array of Multipart objects containing all the data. The order of the multipart form data in the request should be preserved. [RFC7578 5.2](https://tools.ietf.org/html/rfc7578#section-5.2). The boundary delimiter MUST NOT appear inside any of the encapsulated parts. Note that the boundary delimiter does not need to have '-' characters, but a line using the boundary delimiter will start with '--' and end in . [RFC2046 5.1](https://tools.ietf.org/html/rfc2046#section-5.1.1) 4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jlڻC find_header_boundary(bytes) Find the end of the multipart header in the byte array. Returns a Tuple with the start index(1) and the end index. Headers are separated from the body by CRLFCRLF. [RFC2046 5.1](https://tools.ietf.org/html/rfc2046#section-5.1) [RFC822 3.1](https://tools.ietf.org/html/rfc822#section-3.1) 4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jlڻ parse_multipart_body(body, boundary)::Vector{Multipart} Parse the multipart body received from the client breaking it into the various chunks which are returned as an array of Multipart objects. 4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jlڻ parse_multipart_chunk(chunk) Parse a single multi-part chunk into a Multipart object. This will decode the header and extract the contents from the byte array. 4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jlڻ find_multipart_boundary(bytes, boundaryDelimiter; start::Int=1) Find the first and last index of the next boundary delimiting a part, and if the discovered boundary is the terminating boundary. 638 + I?.{ I-!P. O?-!Z6+ I . L . L .!M .!M.Q  637= I.X I.!P . O?-!Z6+3 I??7>++?/#96389638/#96389638/#96389638/#96389638,/#96389638,/#96389638,?#self#aijbvallk638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#x638wgzipContent-EncodingNaNContent-LengthContent-Disposition~X +q I I- 9638 I A 9638 I A 9638 I A 9638  . 0496386 3  . L49638 I -9638 I .9638 9638-e -k6+. L49638. 3+. 0496386+3+  . L49638-96386+#7?3+#. L49638 . L49638 A9638#$%. L49638 A '49638&: A9638 9638 9638 .)* A 49638+ A 49638 I A9638 A9638 A 49638/.9638 9638 .Q1963862+>. 04963864+73+9  . L49638-96389 A 49638:9638 A 49638<9638- . L49638- @. L49638- B. L49638- D. L49638- F. L49638- H A K>?ACEGI. L49638. L49638 . L49638. L49638. L49638. L49638 I RJKLMNOPQRST!96389638- . L49638- Y A KWXZ. L49638 I R[\]^_`. L49638 . 0c496386d+g3+i. Lc49638 AVbi9638. L49638-9638k-kl6m+q A7o7?+q+q?/#96389638,k/#96389638,m/#96389638,n/#96389638,o/#96389638,q/#96389638,r/#96389638,s/#96389638,t/#96389638,u/#96389638,w/#96389638,x/#96389638,y/#96389638,|/#96389638,/#96389638,/#96389638,? #self#stream#12report_callbackprev_timestart_timedownloaded_bytestotal_bytescontent_disprespstreamstreamstreamfilestream638k +4. L49638. 04963863. L49638-9638-k6 +4. L49638. 0 496386 3. L 49638. L49638. 0496386+3+. L49638-9638.[.X. L49638 A 49638. L49638-9638-k6 +3 A9638. L49638. 0#496386$+'3+). L#49638.["). L49638.s++-,-9638 -.|*.6/+3. L49638 A137?+4+4?/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,/#9638 9638 ,?3#self#fhstreamdownloaded_bytesstreamprev_time638 Downloading./opt/julia/packages/HTTP/sJD5V/src/download.jl/  + A9638. L49638 A 49638. L49638. 0 496386 3. L 49638. L49638.[.!J4 I.9638+. L49638. 0496386+3+. L49638 I.9638. L49638. 0496386+ 3+". L49638. L49638. 0#496386$+'3+). L#49638 I.[") I.9638. L49638. 0,496386-+03+2. L,49638. L49638. 034963864+73+9. L349638 I.963829      I96389638 I-!M9638 .9638EF6G+ I49638 I # I A9638  .9638O 9638V-9638kL6M+ I 49638 A96389638 9638   6P+ I 9638.9638w 96386S+W!9638 I -U I + V+ I96389638. K iZ. L49638. L49638. 0]496386^+a3+c. L]49638. L49638.9638de. L49638.9638gh. L49638.9638jk. L49638.9638mn. L49638. 0p496386q+t3+v. Lp49638. L49638.9638vw. L49638.9638yz. L49638. 0|496386}+3+. L|49638. L49638.9638 A F\cfilox{ I-[ I> W3+ W I  A!9638 96389638     > I= ~X6+ A!i.!@-!e6+ A96389638 9638     3+ A 96389638 9638     3+9638V7++?+/#96389638,}/#96389638,~/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,?  #self#completion_progressremaining_timeremaining_bytesaverage_speedtaken_timemsgkwargslinefileidlogger_modulegroupstd_levellevelerrprev_timedownloaded_bytestotal_bytesdownloaded_bytesdownloaded_bytestotal_bytesfiledownloaded_bytestotal_bytes638/sj. L49638-.s96387?/#96389638,d? #self#x638 s9638. K i- F- A .!y96387?/#96389638,c? #self#x638∞ B-9638-k679638!9638.-7?/#96389638,b? #self#x638q9638. K i- F- A 7?/#96389638,a? #self#x638GET downloading ./opt/julia/packages/HTTP/sJD5V/src/download.jlX +_? I A 9638 I R9638 I R9638 I R96389638-  . K I R   I96389638 I-!M9638.96386+= I9638 I# I A9638 .9638O9638V-9638k6+= I49638 A96389638 9638 6!+= I9638 .9638w96386$+(!9638 I-& I+g V+/ I.!y9638 I A i I> W3+4 W I  A!9638 96389638> I= ~)6+= A!i.!@5-!e667+; A96389638 96383+< A 696389638 96383+=9638V I -!M9638- - - -  -  -  -  -  A K?@ABCDEFG     I RHIJKLM A!i.!@P-!eQ6R+W9638 ATO96383+Y9638 A QWO9638. 0 496386Y+\3+^. L 496387^+_+_?+ /#96389638,a/#96389638,b/#96389638,c/#96389638,d/#96389638,g/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,h/#96389638,i/#96389638,j/#96389638,?  #download#10update_periodkwurllocal_pathheaders#11filehdrsformat_bytes_per_secondformat_secondsformat_bytesformat_progressmsgkwargslinefileidlogger_modulegroupstd_levellevelerrfile638m A i-! A96387?/#96389638,`?#self#urllocal_pathheaders638^H-!M9638 A7?/#96389638,`?#self#urllocal_path638`HV-!M9638 A7?/#96389638,`? #self#url638I-96386-9638.!J49638-9638 A9638-9638 I A9638.96387 7?/#96389638 ,>/#96389638 ,A/#96389638 ,H/#96389638 ,K?#self#pathresphdrsfilename638g A9638 A96387?/#96389638,:?#self##unused#resphdrs638/Z +'.QG63.Q963867V3-9638.!J49638-9638 . L49638 A  49638 . L49638. 0 4963863. L 49638.QG6+ . L49638. 0496386+3+. L49638-9638-7. L49638. 0 496386!+$3+&. L 496387&+'+'?/#96389638,(/#96389638,)/#96389638,*?#self#tffile_from_targetf638V X +- I A 9638 I A 9638 R9638 A 49638 I.!J4y.?V6.!J4y I.!J 496383. 0496386 3. L49638.!J49638- A 49638. 0496386+3+. L49638.?V6+%. 0496386+ 3+"  . L496387"3+%. 0496386%+(3+*  . L49638.!J49638-*+7,+-+-?/#96389638,'/#96389638,./#96389638,//#96389638,0/#96389638,1/#96389638,2/#96389638,3/#96389638,6?Z#self#reqforeqfile_from_targetfile_from_targetfile_from_targetfffile_from_target638"(.*)"filename\s*=\s*(.*)+ I-!P. O?-!Z6+ I. L. L I.96389638.?V6 + I.!M I.96389638.?V6.!M I-9638.QG6+7V7 I.!P . O?-!Z6+37V++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638, /#96389638,"/#96389638,#? A#self#hdrscontent_dispquoted_filenamefilenamefilename_part638begins with "/". contains "..". ..-Possible directory traversal attack detected..+ I9638 I-!P. O?-!Z6+ I. L. L.963896386 .!y9638.9638  -U3.96389638/6+.!y9638.9638-U3+ I.!P . O?-!Z6+3- F A }!P7+ + ?/#96389638 /#96389638 /#96389638 /#96389638 /#96389638 /#96389638 ?$#self#basepartpartsexplainpart638o. L49638 A i-! A7?/#96389638,5?#self#req_or_stream638 _duration_ms_count +1? I -9638. L49638 I-9638 I.g9638 I.g9638 I A9638!Q.!J 49638 A  .X .!J 49638 A!x   V+ I + A!i.!@-!e6+. L49638 I - I W3+!. L49638 I A  I W3+! W I !Q.!J 49638 A!"# A9638.[%.s&+.X$'.!J 49638 A!x)(. O 6++. A!. O 6.+17 7 +1+1?/#96389638,6/#96389638,7/#96389638,8/#96389638,9/#96389638,:/#96389638,;/#96389638,</#96389638,=/#96389638,?? B#observation#6kwreq_or_streamstart_timedurnmcntnmnmreq638HX9638- . K I R9638- . K I R A z== 7 ?/#96389638,5?#self#f6observation638<7?/#96389638,0? #self#r638d.!J49638.!J496387?/#96389638,1? #self#s638"" " "" .HTTP/ ] " [ - user-agent-referer%d/%b/%Y:%H:%M:%S %z+.!J49638.!J49638.!J963849638 A9638.9638.!J49638.!J49638.!J49638.!J49638.!J49638.!J 49638 .!J 49638 .!J49638.!J 49638 .!J49638 .!J49638.!J49638 .!J49638 .!J49638.9638.!J49638 A963896389638.!J49638 A96389638 A 96389638963896389638 96389638 9638963896389638963896387++?/#9638^?#self#iohttp638" ] " [ - P+.!J49638.!J49638.!J963849638 A9638.9638.!J49638.!J49638.!J49638.!J49638.!J49638.!J 49638 .!J 49638 .!J49638.!J 49638 .!J49638 .!J49638.!J49638 .!J49638 .!J49638. A 96389638963896389638 96389638 9638963896387++?/#9638^?#self#iohttp638  @ (08unknown variable in logfmt: dd/u/yyyy:HH:MM:SSyyyy-mm-dd\THH:MM:SS%FT%T%z^sent_http_(.+)$ ^http_(.+)$ +\ I-y I.96389638.?V6.!M-.9638_9638- I.9638  49638 49638 A 4A  96387 I.96389638.?V6+.!M-.9638_9638- I.9638 49638 49638  A 4A96387.O49638 6+! 49638 7.O49638 6!+% 49638 7#.O496386%+(749638.O496386(+2.!J963849638 A*-k+6,+0 496387. 4963870.O4963862+<.!J963849638 A4-k566+: 4963878 496387:.O496386<+D I-963849638 I-963849638 I-963849638 A F96389638 A }!P FA7B.O496386D+H 496387F.O496386H+L 496387J.O496386L+R 49638 49638 A F9638!N9638"O7P.O49638#6R+V 49638$7T.O49638%6V+Z 49638&7X.!y9638'-IZ7[+\+\?+'/#96389638(,</#96389638(,=/#96389638(,=/#96389638(,>/#96389638(,?/#96389638(,@/#96389638(,@/#96389638(,A/#96389638(,B/#96389638(,C/#96389638(,D/#96389638(,E/#96389638(,F/#96389638(,G/#96389638(,H/#96389638(,I/#96389638(,J/#96389638(,K/#96389638(,O/#96389638(,Q/#96389638(,R/#96389638(,S/#96389638(,W/#96389638(,Y/#96389638(,Z/#96389638(,[/#96389638(,\/#96389638(,]/#96389638(,^/#96389638(,_/#96389638(,`/#96389638(,a/#96389638(,b/#96389638(,c/#96389638(,d/#96389638(,e/#96389638(,f/#96389638(,g/#96389638(,i?  !!"""##$%%&&''#self#spthdrmstr638f +@ I  I - I-!Mg I AZ4A4 49638 I- .f6 +> -Q9638$ I A9638.O V6+ I - .!J49638 .{ .!M-.3+>.| 6+%.!J49638 .9638  .{ .!M!-".#.  9638. K i&- F=-'(.!J96384 A )*+%.!l, I . L- I. L- A!l, I . L0 I-9638 .w63+:.!J49638- F6 A }!P573+<.!J49638.: I 3 AZ4F4963849638 I AZ49638 >7+@+@?/#9638 9638 ,$/#9638 9638 ,%/#9638 9638 ,&/#9638 9638 ,'/#9638 9638 ,(/#9638 9638 ,)/#9638 9638 ,*/#9638 9638 ,+/#9638 9638 ,,/#9638 9638 ,-/#9638 9638 ,//#9638 9638 ,0/#9638 9638 ,2/#9638 9638 ,3/#9638 9638 ,4/#9638 9638 ,5/#9638 9638 ,6/#9638 9638 ,7/#9638 9638 ,8?  #self#sfiexvarsesymjs*/opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.put(url, headers, body; ) -> HTTP.Response Shorthand for `HTTP.request("PUT", ...)`. See [`HTTP.request`](@ref). */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlFڻ HTTP.openraw(method, url, [, headers])::Tuple{Connection, Response} Open a raw socket that is unmanaged by HTTP.jl. Useful for doing HTTP upgrades to other protocols. Any bytes of the body read from the socket when reading headers, is returned as excess bytes in the last tuple argument. Example of a WebSocket upgrade: ```julia headers = Dict( "Upgrade" => "websocket", "Connection" => "Upgrade", "Sec-WebSocket-Key" => "dGhlIHNhbXBsZSBub25jZQ==", "Sec-WebSocket-Version" => "13") socket, response, excess = HTTP.openraw("GET", "ws://echo.websocket.org", headers) # Write a WebSocket frame frame = UInt8[0x81, 0x85, 0x37, 0xfa, 0x21, 0x3d, 0x7f, 0x9f, 0x4d, 0x51, 0x58] write(socket, frame) ``` */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.pushfirstlayer!(layer; request=true) Push a layer to the start of the stack of layers that will be applied to all requests. The "layer" is expected to be a function that takes and returns a `Handler` function. See [`Layer`](@ref) for more details. If `request=false`, the layer is expected to take and return a "stream" handler function. The custom `layer` will be put on the bottom of the stack, so it will be the last layer executed. To add a layer at the top of the stack, see [`HTTP.pushlayer!`](@ref). 0/opt/julia/packages/HTTP/sJD5V/src/access_log.jlڻs combined_logfmt(io::IO, http::HTTP.Stream) Format a log message in the Combined Log Format and write to `io`. */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.pushlayer!(layer; request=true) Push a layer onto the stack of layers that will be applied to all requests. The "layer" is expected to be a function that takes and returns a `Handler` function. See [`Layer`](@ref) for more details. If `request=false`, the layer is expected to take and return a "stream" handler function. The custom `layer` will be put on the top of the stack, so it will be the first layer executed. To add a layer at the bottom of the stack, see [`HTTP.pushfirstlayer!`](@ref). */opt/julia/packages/HTTP/sJD5V/src/HTTP.jliڻh parse(Request, str) parse(Response, str) Parse a string into a `Request` or `Response` object. */opt/julia/packages/HTTP/sJD5V/src/HTTP.jl$ڻ HTTP.delete(url [, headers]; ) -> HTTP.Response Shorthand for `HTTP.request("DELETE", ...)`. See [`HTTP.request`](@ref). */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.poplayer!(; request=true) Inverse of [`HTTP.pushlayer!`](@ref), removes the top layer of the global HTTP.jl layer stack. Can be used to "cleanup" after a custom layer has been added. If `request=false`, will remove the top "stream" layer as opposed to top "request" layer. */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ. HTTP.popfirstlayer!(; request=true) Inverse of [`HTTP.pushfirstlayer!`](@ref), removes the bottom layer of the global HTTP.jl layer stack. Can be used to "cleanup" after a custom layer has been added. If `request=false`, will remove the bottom "stream" layer as opposed to bottom "request" layer. */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.post(url, headers, body; ) -> HTTP.Response Shorthand for `HTTP.request("POST", ...)`. See [`HTTP.request`](@ref). */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.patch(url, headers, body; ) -> HTTP.Response Shorthand for `HTTP.request("PATCH", ...)`. See [`HTTP.request`](@ref). 0/opt/julia/packages/HTTP/sJD5V/src/access_log.jlڻ logfmt"..." Parse an [NGINX-style log format string](https://nginx.org/en/docs/http/ngx_http_log_module.html#log_format) and return a function mapping `(io::IO, http::HTTP.Stream) -> body` suitable for passing to [`HTTP.listen`](@ref) using the `access_log` keyword argument. The following variables are currently supported: - `$http_name`: arbitrary request header (with `-` replaced with `_`, e.g. `http_user_agent`) - `$sent_http_name`: arbitrary response header (with `-` replaced with `_`) - `$request`: the request line, e.g. `GET /index.html HTTP/1.1` - `$request_method`: the request method - `$request_uri`: the request URI - `$remote_addr`: client address - `$remote_port`: client port - `$remote_user`: user name supplied with the Basic authentication - `$server_protocol`: server protocol - `$time_iso8601`: local time in ISO8601 format - `$time_local`: local time in Common Log Format - `$status`: response status code - `$body_bytes_sent`: number of bytes in response body ## Examples ```julia logfmt"[$time_iso8601] \"$request\" $status" # [2021-05-01T12:34:40+0100] "GET /index.html HTTP/1.1" 200 logfmt"$remote_addr \"$http_user_agent\"" # 127.0.0.1 "curl/7.47.0" ``` */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ Layer Abstract type to represent a client-side middleware that exists for documentation purposes. A layer is any function of the form `f(::Handler) -> Handler`, where [`Handler`](@ref) is a function of the form `f(::Request) -> Response`. Note that the `Handler` definition is from the server-side documentation, and is "hard-coded" on the client side. It may also be apparent that a `Layer` is the same as the [`Middleware`](@ref) interface from server-side, which is true, but we define `Layer` to clarify the client-side distinction and its unique usage. Custom layers can be deployed in one of two ways: * [`HTTP.@client`](@ref): Create a custom "client" with shorthand verb definitions, but which include custom layers; only these new verb methods will use the custom layers. * [`HTTP.pushlayer!`](@ref)/[`HTTP.poplayer!`](@ref): Allows globally adding and removing layers from the default HTTP.jl layer stack; *all* http requests will then use the custom layers ### Quick Examples ```julia module Auth using HTTP function auth_layer(handler) # returns a `Handler` function; check for a custom keyword arg `authcreds` that # a user would pass like `HTTP.get(...; authcreds=creds)`. # We also accept trailing keyword args `kw...` and pass them along later. return function(req; authcreds=nothing, kw...) # only apply the auth layer if the user passed `authcreds` if authcreds !== nothing # we add a custom header with stringified auth creds HTTP.setheader(req, "X-Auth-Creds" => string(authcreds)) end # pass the request along to the next layer by calling `auth_layer` arg `handler` # also pass along the trailing keyword args `kw...` return handler(req; kw...) end end # Create a new client with the auth layer added HTTP.@client [auth_layer] end # module # Can now use custom client like: Auth.get(url; authcreds=creds) # performs GET request with auth_layer layer included # Or can include layer globally in all HTTP.jl requests HTTP.pushlayer!(Auth.auth_layer) # Now can use normal HTTP.jl methods and auth_layer will be included HTTP.get(url; authcreds=creds) ``` */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.@client requestlayers HTTP.@client requestlayers streamlayers HTTP.@client (first=requestlayers, last=requestlayers) (first=streamlayers, last=streamlayers) Convenience macro for creating a custom HTTP.jl client that will include custom layers when performing requests. It's common to want to define a custom [`Layer`](@ref) to enhance a specific category of requests, such as custom authentcation for a web API. Instead of affecting the global HTTP.jl request stack via [`HTTP.pushlayer!`](@ref), a custom wrapper client can be defined with convenient shorthand methods. See [`Layer`](@ref) for an example of defining a custom layer and creating a new client that includes the layer. Custom layer arguments can be provided as a collection of request or stream-based layers; alternatively, a NamedTuple with keys `first` and `last` can be provided with values being a collection of layers. The NamedTuple form provides finer control over the order in which the layers will be included in the default http layer stack: `first` request layers are executed before all other layers, `last` request layers are executed right before all stream layers, and similarly for stream layers. An empty collection can always be passed for request or stream layers when not needed. One use case for custom clients is to control the value of standard `HTTP.request` keyword arguments. This can be achieved by passing a `(first=[defaultkeywordlayer],)` where `defaultkeywordlayer` is defined like: ```julia defaultkeywordlayer(handler) = (req; kw...) -> handler(req; retry=false, redirect=false, kw...) ``` This client-side layer is basically a no-op as it doesn't modify the request at all, except that it hard-codes the value of the `retry` and `redirect` keyword arguments. When we pass this layer as `(first=[defaultkeywordlayer],)` this ensures this layer will be executed before all other layers, effectively over-writing the default and any user-provided keyword arguments for `retry` or `redirect`. ./opt/julia/packages/HTTP/sJD5V/src/download.jlڻ safer_joinpath(basepart, parts...) A variation on `joinpath`, that is more resistant to directory traversal attacks. The parts to be joined (excluding the `basepart`), are not allowed to contain `..`, or begin with a `/`. If they do then this throws an `DomainError`. ./opt/julia/packages/HTTP/sJD5V/src/download.jlڻ download(url, [local_path], [headers]; update_period=1, kw...) Similar to `Base.download` this downloads a file, returning the filename. If the `local_path`: - is not provided, then it is saved in a temporary directory - if part to a directory is provided then it is saved into that directory - otherwise the local path is uses as the filename to save to. When saving into a directory, the filename is determined (where possible), from the rules of the HTTP. - `update_period` controls how often (in seconds) to report the progress. - set to `Inf` to disable reporting - `headers` specifies headers to be used for the HTTP GET request - any additional keyword args (`kw...`) are passed on to the HTTP request. */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.get(url [, headers]; ) -> HTTP.Response Shorthand for `HTTP.request("GET", ...)`. See [`HTTP.request`](@ref). 0/opt/julia/packages/HTTP/sJD5V/src/access_log.jlڻo common_logfmt(io::IO, http::HTTP.Stream) Format a log message in the Common Log Format and write to `io`. */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ[) HTTP.request(method, url [, headers [, body]]; ]) -> HTTP.Response Send a HTTP Request Message and receive a HTTP Response Message. e.g. ```julia r = HTTP.request("GET", "http://httpbin.org/ip") r = HTTP.get("http://httpbin.org/ip") # equivalent shortcut println(r.status) println(String(r.body)) ``` `headers` can be any collection where `[string(k) => string(v) for (k,v) in headers]` yields `Vector{Pair}`. e.g. a `Dict()`, a `Vector{Tuple}`, a `Vector{Pair}` or an iterator. By convention, if a header _value_ is an empty string, it will not be written when sending a request (following the curl convention). By default, a copy of provided headers is made (since required headers are typically set during the request); to avoid this copy and have HTTP.jl mutate the provided headers array, pass `copyheaders=false` as an additional keyword argument to the request. The `body` argument can be a variety of objects: - an `AbstractDict` or `NamedTuple` to be serialized as the "application/x-www-form-urlencoded" content type - any `AbstractString` or `AbstractVector{UInt8}` which will be sent "as is" for the request body - a readable `IO` stream or any `IO`-like type `T` for which `eof(T)` and `readavailable(T)` are defined. This stream will be read and sent until `eof` is `true`. This object should support the `mark`/`reset` methods if request retries are desired (if not, no retries will be attempted). - Any collection or iterable of the above (`AbstractDict`, `AbstractString`, `AbstractVector{UInt8}`, or `IO`) which will result in a "chunked" request body, where each iterated element will be sent as a separate chunk - a [`HTTP.Form`](@ref), which will be serialized as the "multipart/form-data" content-type The `HTTP.Response` struct contains: - `status::Int16` e.g. `200` - `headers::Vector{Pair{String,String}}` e.g. ["Server" => "Apache", "Content-Type" => "text/html"] - `body::Vector{UInt8}` or `::IO`, the Response Body bytes or the `io` argument provided via the `response_stream` keyword argument Functions `HTTP.get`, `HTTP.put`, `HTTP.post` and `HTTP.head` are defined as shorthand for `HTTP.request("GET", ...)`, etc. Supported optional keyword arguments: - `query = nothing`, a `Pair` or `Dict` of key => values to be included in the url - `response_stream = nothing`, a writeable `IO` stream or any `IO`-like type `T` for which `write(T, AbstractVector{UInt8})` is defined. The response body will be written to this stream instead of returned as a `Vector{UInt8}`. - `verbose = 0`, set to `1` or `2` for increasingly verbose logging of the request and response process - `connect_timeout = 30`, close the connection after this many seconds if it is still attempting to connect. Use `connect_timeout = 0` to disable. - `pool = nothing`, an `HTTP.Pool` object to use for managing the reuse of connections between requests. By default, a global pool is used, which is shared across all requests. To create a pool for a specific set of requests, use `pool = HTTP.Pool(max::Int)`, where `max` controls the maximum number of concurrent connections allowed to be used for requests at a given time. - `readtimeout = 0`, abort a request after this many seconds. Will trigger retries if applicable. Use `readtimeout = 0` to disable. - `status_exception = true`, throw `HTTP.StatusError` for response status >= 300. - Basic authentication is detected automatically from the provided url's `userinfo` (in the form `scheme://user:password@host`) and adds the `Authorization: Basic` header; this can be disabled by passing `basicauth=false` - `canonicalize_headers = false`, rewrite request and response headers in Canonical-Camel-Dash-Format. - `proxy = proxyurl`, pass request through a proxy given as a url; alternatively, the `http_proxy`, `HTTP_PROXY`, `https_proxy`, `HTTPS_PROXY`, and `no_proxy` environment variables are also detected/used; if set, they will be used automatically when making requests. - `detect_content_type = false`: if `true` and the request body is not a form or `IO`, it will be inspected and the "Content-Type" header will be set to the detected content type. - `decompress = nothing`, by default, decompress the response body if the response has a "Content-Encoding" header set to "gzip". If `decompress=true`, decompress the response body regardless of `Content-Encoding` header. If `decompress=false`, do not decompress the response body. - `logerrors = false`, if `true`, `HTTP.StatusError`, `HTTP.TimeoutError`, `HTTP.IOError`, and `HTTP.ConnectError` will be logged via `@error` as they happen, regardless of whether the request is then retried or not. Useful for debugging or monitoring requests where there's worry of certain errors happening but ignored because of retries. - `logtag = nothing`, if provided, will be used as the tag for error logging. Useful for debugging or monitoring requests. - `observelayers = false`, if `true`, enables the `HTTP.observelayer` to wrap each client-side "layer" to track the amount of time spent in each layer as a request is processed. This can be useful for debugging performance issues. Note that when retries or redirects happen, the time spent in each layer is cumulative, as noted by the `[layer]_count`. The metrics are stored in the `Request.context` dictionary, and can be accessed like `HTTP.get(...).request.context` Retry arguments: - `retry = true`, retry idempotent requests in case of error. - `retries = 4`, number of times to retry. - `retry_non_idempotent = false`, retry non-idempotent requests too. e.g. POST. - `retry_delays = ExponentialBackOff(n = retries)`, provide a custom `ExponentialBackOff` object to control the delay between retries. - `retry_check = (s, ex, req, resp, resp_body) -> Bool`, provide a custom function to control whether a retry should be attempted. The function should accept 5 arguments: the delay state, exception, request, response (an `HTTP.Response` object *if* a request was successfully made, otherwise `nothing`), and `resp_body` response body (which may be `nothing` if there is no response yet, otherwise a `Vector{UInt8}`), and return `true` if a retry should be attempted. Redirect arguments: - `redirect = true`, follow 3xx redirect responses; i.e. additional requests will be made to the redirected location - `redirect_limit = 3`, maximum number of times a redirect will be followed - `redirect_method = nothing`, the method to use for the redirected request; by default, GET will be used, only responses with 307/308 will use the same original request method. Pass `redirect_method=:same` to pass the same method as the orginal request though note that some servers may not respond/accept the same method. It's also valid to pass the exact method to use as a string, like `redirect_method="PUT"`. - `forwardheaders = true`, forward original headers on redirect. SSL arguments: - `require_ssl_verification = NetworkOptions.verify_host(host)`, pass `MBEDTLS_SSL_VERIFY_REQUIRED` to the mbed TLS library. ["... peer must present a valid certificate, handshake is aborted if verification failed."](https://tls.mbed.org/api/ssl_8h.html#a5695285c9dbfefec295012b566290f37) - `sslconfig = SSLConfig(require_ssl_verification)` - `socket_type_tls = MbedTLS.SSLContext`, the type of socket to use for TLS connections. Defaults to `MbedTLS.SSLContext`. Also supported is passing `socket_type_tls = OpenSSL.SSLStream`. To change the global default, set `HTTP.SOCKET_TYPE_TLS[] = OpenSSL.SSLStream`. Cookie arguments: - `cookies::Union{Bool, Dict{<:AbstractString, <:AbstractString}} = true`, enable cookies, or alternatively, pass a `Dict{AbstractString, AbstractString}` of name-value pairs to manually pass cookies in the request "Cookie" header - `cookiejar::HTTP.CookieJar=HTTP.COOKIEJAR`: threadsafe cookie jar struct for keeping track of cookies per host; a global cookie jar is used by default. ## Request Body Examples String body: ```julia HTTP.request("POST", "http://httpbin.org/post", [], "post body data") ``` Stream body from file: ```julia io = open("post_data.txt", "r") HTTP.request("POST", "http://httpbin.org/post", [], io) ``` Generator body: ```julia chunks = ("chunk$i" for i in 1:1000) HTTP.request("POST", "http://httpbin.org/post", [], chunks) ``` Collection body: ```julia chunks = [preamble_chunk, data_chunk, checksum(data_chunk)] HTTP.request("POST", "http://httpbin.org/post", [], chunks) ``` `open() do io` body: ```julia HTTP.open("POST", "http://httpbin.org/post") do io write(io, preamble_chunk) write(io, data_chunk) write(io, checksum(data_chunk)) end ``` ## Response Body Examples String body: ```julia r = HTTP.request("GET", "http://httpbin.org/get") println(String(r.body)) ``` Stream body to file: ```julia io = open("get_data.txt", "w") r = HTTP.request("GET", "http://httpbin.org/get", response_stream=io) close(io) println(read("get_data.txt")) ``` Stream body through buffer: ```julia r = HTTP.get("http://httpbin.org/get", response_stream=IOBuffer()) println(String(take!(r.body))) ``` Stream body through `open() do io`: ```julia r = HTTP.open("GET", "http://httpbin.org/stream/10") do io while !eof(io) println(String(readavailable(io))) end end HTTP.open("GET", "https://tinyurl.com/bach-cello-suite-1-ogg") do http n = 0 r = startread(http) l = parse(Int, HTTP.header(r, "Content-Length")) open(`vlc -q --play-and-exit --intf dummy -`, "w") do vlc while !eof(http) bytes = readavailable(http) write(vlc, bytes) n += length(bytes) println("streamed $n-bytes $((100*n)÷l)%\u1b[1A") end end end ``` Interfacing with RESTful JSON APIs: ```julia using JSON params = Dict("user"=>"RAO...tjN", "token"=>"NzU...Wnp", "message"=>"Hello!") url = "http://api.domain.com/1/messages.json" r = HTTP.post(url, body=JSON.json(params)) println(JSON.parse(String(r.body))) ``` Stream bodies from and to files: ```julia in = open("foo.png", "r") out = open("foo.jpg", "w") HTTP.request("POST", "http://convert.com/png2jpg", [], in, response_stream=out) ``` Stream bodies through: `open() do io`: ```julia HTTP.open("POST", "http://music.com/play") do io write(io, JSON.json([ "auth" => "12345XXXX", "song_id" => 7, ])) r = startread(io) @show r.status while !eof(io) bytes = readavailable(io) play_audio(bytes) end end ``` */opt/julia/packages/HTTP/sJD5V/src/HTTP.jlڻ HTTP.head(url; ) -> HTTP.Response Shorthand for `HTTP.request("HEAD", ...)`. See [`HTTP.request`](@ref). */opt/julia/packages/HTTP/sJD5V/src/HTTP.jl.ڻC HTTP.open(method, url, [,headers]) do io write(io, body) [startread(io) -> HTTP.Response] while !eof(io) readavailable(io) -> AbstractVector{UInt8} end end -> HTTP.Response The `HTTP.open` API allows the request body to be written to (and/or the response body to be read from) an `IO` stream. e.g. Streaming an audio file to the `vlc` player: ```julia HTTP.open(:GET, "https://tinyurl.com/bach-cello-suite-1-ogg") do http open(`vlc -q --play-and-exit --intf dummy -`, "w") do vlc write(vlc, http) end end ``` 638 0 < tid <= v` ?6=7?-!l9638-!U7?/#96389638,?#self#6380`escape` is deprecated, use `escapeuri` instead.\ ?? 9638-9638.!J49638.!J49638.!J49638.!96389638 A!i.!@ -!e 6 A }!P96387 . F 9638 A }!P 7?/#96389638,r/#96389638,s/#96389638,t?#escape#1kwargsargs638y ?9638 A i-!. F A }!P7?/#96389638,q? #self#argsR A !963887@@`?'//#9638?638L A !96387?/#9638? #self#x638P A !96387?/#9638?#self#mapexprx638X. 963896387?/#96389638? #self#xM\ ,-y V%U% ! !  >  =#_2B,{~k-l./   =12~}q |}QT"#p 12~G P  "#p  y WXYZ\ _`aS/ZLW    # (  #     x 2{ Cus#2 =(     # y        je>$ - ? 3I$ z # @12y{= ~ rCWqXY#_ Sq: t _AVBD.-V T .~ w x y { | } w x y z 6njv  u t #a12yrsn !Bs ,-yr V%q x@KyPp o Pn m 2l :{Dy{zD,-yk j i fh a g y,-yf e d fc a b [] U V W X Y $%Z [ \ 11] 6z ^ _ ` qp/on;HRR _S y{456@T .|{KQ P 9O I N *+<;M "y#$bK B L !H J F G B H I E A B C D GFfq@ A ? 8 > : = 8 < : ; "#p8 9 : 7 6 3 4 5 0 1 2 / , - . / * +  % & ' ( ) # $ "#p! "    yfq:  Ag#5  '! D    78# f q  _6p D1 E  Tp>7MU  IR     }#= F  { ~ Ry x   yxw v  t x 2{ C~|zus p:[]   " #pl  j i U.,)  f*e d c 1 g/b: ha 6 dmke` T ^  ]\#1~ G _P[ Z Y,-y WP N U T S VR Q["]#p  N= = 2t  XP|zOML["U]#c6 upCKT[] JI{x1z{ ~ Dqpon;JHR G#2= F E =  B A @$ <[] ; : 9 #8 y 7 6 3 43 432 =<51 0 je>/ $ .- ?, + T  )(] %  $2 "rs !     rsR rs #      ~ } z { | y w x $u v  q r s t  o p  $n jb m g k l j d e f g h i ` a b c Z [ \ ] ^ _ &%Y X V W 'U T S vR C Q >6WXY_SLO P yM M N KVVK L yI I J KG H yE E F K qD >  B 1K2Y@3= > ? > 12@ A BB u1vEFC GIKY@WXY< _SL: ; je9 8  !?7  2yB6 B 4 #18~@5 qK 3 @2 K) ( >BS 2y >#y& ( , - 1 ba{V0 . :?#/1y 4& ' 5( ) t61z~* + , - . / A|{@a?$ % # BB" :z`HcI ! je <v>1~J \1 # 2= tuv  y `IWXY\     _`  SL  WXY_SL .\     P   ;     y 1.@ 71>CD  y  _gVDE>V e!6 3;>#?@ ^A  yB 6v~ _IHKWXY_ SL jeX x!   B    6 " #^ p(_  [ ] $~r{ [] ^cDv(kCT-{[  ]  cDxvkCT D #1 p# =>x2yz{ ~ J$ z # @12y{= ~ rDC*WqXY#_ S*rq: t HLk JMz|c=X#^16I [JD?2(1caJ deH t |zH tb|zc# JD?cgtJ H YH Zt|z  V{   -- { ~  {}  {xz  yx  v u t s rbD  ^n  l k a) h g f 1 i/e: jd =6 hmcP N a ` _#  f^  \ [ Z X W  V:c9 ' $%- {~ !]YUT'{ c=r 9 '  #| } ~ ^- r1(   * . ?(!|w(qpobz}"Tcx y 6z uS6v w Rr s t u ?Q cXtbn o p q JPm Oh l Li ),{ Hh Xi tj k J|zNMf g LX|Xze jeFEEVd XYZ6[H$cb:\ @a b c C` B] ^ _ A:\ @/2HZ I>Y #HZ 3tI~[ >}N=X <yW ;V tuv:T U yP 8 WXY\O P Q R _`S S987LM N 6GL 5K 4&caJ deH tI 1|zG F .E -5 @ A B C D /,+? *= > ):2< '"#p"#p12~G: ; P%$U.9 . 8  7 6 5 0 1 2 3 4 / - . , ++ ~d c' ( ) * !,-y% & $ # " ! K   ,-y >   ?   rs       )    1  /:   6  P N    #1~GP.{.=$%rVt.   |zcr6*(&#z}"KL,-y= 1R#f)1/:6PN#1~GP,L12yt6a|zc#^1JD?32(0cbjeFEaPNX2rqlp,-y  e]6"#p{y!D!~vw2!:x^yz{|}r|oku^(tsrq8plmnochijkcadefgab`_]^X\VWXYZ6[TUGSRHtOPQJIHKLM"{N3H)IJ{GFEf`CCDgVE>VBA8@6?\><=y8h& WXY7\89:_`;SL5634210/-.+(),#{*}=[] ()#{fq'&q%8$t)!"#sr q8o)nml{Dj#3t~i`}h\gyei WXY\_`SfedLc  b["U]  #6 yxwvuppkaTdcC#c3t~C}^]y\tuv[yYadfj WXY\_`SZYXLWV F"d#^ p_U [U]T =t~|z`Sq#=RQNL8!F$%I#tHGPNEDvGFC,-yA@?><;JB=:MK9_VD('V7PO86,u=#xz}t69Y? vOUK54y2_AVBD21Vy/ _`AgVBCDE/.I>V0-q86%$[]^6)('&#=",-y{fg qy,-y{fgqy,-y,-y,-yW^FXYZ]\X~}{|fgqjLxyz3v1w::u rst   WXY_SL89:;<@3PRq\IZPq/ptuv 1C63o6]Inje3Z45tuvI/bm!6789:3\;<=>?@/A1B0!D612EFGHIJKLLIH2A@l3\tuvIt3\F &' 6QI_8kvNit3!#&'6_I_ajNat3Z!#&'6_I/_a3iIha\Ngt3\#6_Ia3fIe3\#6GIa3dIca`je1Cb3NIt3\;<? DF6GNaIa^ 3Z<ux\9I/`t3\!#&'6_I_aN t\:<&'?Q|a_^\t\&'_}/012CDt563Z\<EF!u=:;<=#&'*>x? @1yBCDEFGHIJKLMNOPQR6~STUVGHIJ[\]^_KabcLefMNOPiQRSTUVWXYZ[\]^vwxyz_9xrI/|a_^TYaVS+*P <=OAWVSQ6AB>?@<&89:;<=Mje$67y4 *45t$%KDC'F3t$%DC21#12yyzeGbmqlp0S/j.f-+,)**tok/'(y$ WXY\$%&_`SL"#! R#!!#=~zmby_VDVrs_VDV   : :#$%/12 0 u12G  \VA@V&y WXY\_`SL #12y~knl   Gt6&'_&'w_VQT&'_yyyy>y>N2~NX0{Dybt1eG~!?#12rs6e~xwn?vut{zs??#qp6e~n?ml_ji3}2$%1y3rok}hagedc#23t}|}/fba`_^$]$j\$[$jZ,-y$%XW,-y$%UTo<BMfyQ7?KNo<BM]xfyO7?KmNoqr<M:9]xfijL7K54`bcPN=J21vYIHop<;BfgyF76?Nnop<;B]efgyD76?}ve~BA|{uvwxyz@?>tsr9mNnophqr<;:9lkj4d]efghij87654c1^_`abcEC=321\]YZ[0/` UVW*rsXxRG.-S!Tx,aPS) PRQs'}*PQK'Ot$%&DC 136 N6]%M$L#K"_AVBD54VIJy? AB`HI_:G #/012FgA@> ?@_`AgVBCDEI>V=>:#_2{<#;5 : #_12n9 WXY_SL\&'_WXY_8SL 67 5  WXt$%DC4>+3001@#g0{ # "\ #^_1212~DpY)*+=#_2B,{~k-l./  &'(%$"#!6789:  7 =>?@/A1B0!D612EFGHIJKLLE 2A@ t5y  t$%EDC$%x"\#^pY5W|d108 ~TuiaUW|d18 z~TuiUje+; 1l~opWh |TuUWpc|d18e u|fTuiaUljeW 8 |12y+wz~TuiaUjeqW8|12ywy~ Tutsi`U2wb#23tw~b}ytuvy_a2ek WXY\_`SLq#$%_12\VVtt *  &' 6K_P=tQT$%xtQT<>t !#&'6_aP?>t!#t *!#&'6K_aP?  E>f`t!#t  #6EaP? f`  #6WEa #12~2!#F$je~131y{kl  xy@K B#1@K a >t  ;<? DF6WEa^>)KH/0122A@ rst$%EDC6#/g28{~nq  '4!<=!<@<y <@1{=klV  Vn x>}6Uy M69  *7uxs9K}~+wW_@1=eGSzwvz)srq1t/p:uo6xsn#1~GmPblxj:XNhgif_dc=~z{ykebNz`X_!] t :<&'?E|a_^\P=&'_ZYt!#~Q~XTvW!]t 0t!>#}QUT6{|R~/0,1234t56 *  789!u=:;<=#$%&'*>x? @1A2yBCDEFGHIJKLMNOPQR6~STUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz9xrKE|a_^TYaVS+*P(!  ;<>=}OA[WVSQ?,t - !.#9ENMJIBP;t$%87DC* t$%KE54DC( G1+L* t$%KE.-DC t$%E+*DC&z)H:(_Gc'F&u&v t$%E('DC  !"#9NMJIBOOAt &'E@_t  !#&'6E_aP?>t    &' 6E_P=8v<t\963,)&;y8tuv87y5Z\tuv/542z 10y.Z\tuv/.-y+\tuv+*y(\tuv('WXY_SL$ 2y8"!# baW|d108TuiaUW|d108zTuiUje'{~  t1+l~op;  Wh|T uU Wc|d108eufTuiaUje+zW8|12y+wz~Tui Uje' wb2b6&_7W8|12ywy~Tutsi`U#3t~*}jebaW|d108eTu|iaUW|d18ezTu|iU jex{~ eg]eqs#|d1uwaybQ~}z{|yqs#t|d10uvwxaq$%|r2 k1lm~nop]Whi|TjuUgWc|d18eufTu}iaUG6b.#/`a^_]\[Z YW XUVSTRQPONKLMJ:G#H1qrstuvIxyz{}o}|{2~EFDCje//+BA:#1@/z?>45>2?=;<rs:y9874562?301rs/W&'8(|12y)*+wz,~-.TuiU%$6Q#a!"V baW^e2bV~1}u|:#1qrstuvxyz{}o}|{2~ z y jexm v wbt VwbrqwbT>n?mrsl2kjhZgfe2bdc6_a#,XZ^][YZXWVU\TSwbR6_QPW8|12ywy~Twutqspoib`OU#3t~}NjeM $D?|6~~rp/012K2A@J3WXtuvIGFEfqhC"BA#TU;,:9D1 c"#p5!YS2N1NW0:-.,16)+*('&13/%:d$6'64(#PN! X1Hb<@=#1~G"PDa !D#12p7 !D1y6~p8DF136~?>}=<:{DF|1}6~~Dp@:z_cywxyr\rstuvy p#18~q o #n m:8~kl  jhihggfecdab_:\`1\^?\][YZyW>WXqh9yEy #1v#~@=UV6ETQRS/P2ABON>MB!6789:3\;<=>?@/A1B0CD612EFGHIJKLLIH2A@534I2WXY1_SL/0je%.-,#+* ()&'%"y#$b1 !112~a!     6B3y45b:y: 8~ f` 1@#1#~@=   963,)&:WXY_SLje  ,-yd~C|PCx6Fwvmjet#rq!:|}~R2uspz{jeoyxmwluvkVstyriqhpnogfmkljedijhbgaf`e_cdba`[_Z["\]#^pYWFXYZ^]\XfqUVV :NOPQRDSTncWUtLMjeTJKy[R!"#p"#pF12~GHIPONDEMBBC?@AKJ>=H?< G:;rsF92E27 86B3y45b./0122A@-?62,*+<;):(9w'b8&7%6a#$=5"3ba !10/.-,+:#1qrstuvxyz{}2*2~4)(' % $$r " !  #2wb6abafq:#p1qrstuvxyz{|}~2~6   ? rs#  fwb2b1u:#1qrstuvxyz{}2~ z#6a~2bs/yb#e  edwb1z2b#~:1/ybp1|u~:#p1qrstuvwxyz{|}~b2~noml_`abc2defghijkIDC>& WXY[\]_^SRQL1BC?#XZY?XW~CVW/2BUTRSPQNOMKLJI"#pD:H?1GaFE??:D1BC?#@A>?@=~>?<=&_1 ;:9786345 #1 "(021" !"#$%&'()*+/0123456789x_~}|{zvo2  "$%)0~/25{.,-yx+w)*'(u&t%s$rfq"#p! lmkihg      edcyba!f`>&_ &R nj@% !"#$%&'()*+/0123456789x_W~}|{zvo !$%j R9638!V!V R96389638 R9638 R!9638!V& B96389638 R9638796389638 96389638 9638 9638 @00000`?'//#96389638/!96389638 ,1/!9638,C/!96389638/963896389638,"/#96389638?638 A9638 A K9638 A K A.96387?/#96389638?#self#>' % !"#$%&'()*+-/0123456789x_Q~}|{zvo:D" !"#$%&'()*+/0123456789x_~}|{zvo BC]yx >z/ y{  R96388 R9638796389638@00`?'//#96389638,m/!9638#,1/!9638#, ?6389638.  I-9638. w63 I.!N R7 ?/#96389638,m?#ctor-self#str  R963888=879638@p`?'//#96389638,[/#96389638,V?638X A9638=7?/#96389638,[?#self#maskpatcontenttype}Tnj=! +A.4($ A! A!.   .!;.!r A z9638 A!4 S. F4;4=. j  . j  .!O  6 A-U7 R  3+ .! 4 B 9638 A!49638.!L4 R!V!V R!V!V R R R!!V& R R! B A!"4#9638 A!%4"9638.!L'4 R!V!V R!V!V R R*+ R!!V&, R)- R.( B A!/409638 A!24/9638.!L44 R!V!V R!V!V R R78 R!!V&9 R6: R;5 B A!<4=9638 A!?4<7?+A(($($$%%%%@@@@ %!"#%!"$%!"%@+A00pppp0`0ppp`HX`0`000`000000000`0`000000000`0`000000000`0``?+'//#96389638,(/#96389638,)/#96389638,*/#96389638,+/#96389638,,/#96389638,-/9638&,N/'(,q/'(,r/'(,q/'(,r/'(,s/'(,t/'(,u/'(,w/'(,y/)(,9/)(,:/)(,;/!d,w/!d,w/!d,w/ \,/ \,,/!sT,X/!b,/!_T,S,/!zW,,/!xG,</!xG,</!a,&,/!a,',/!a,(,/!a,),/9638*,h/9638*,i/9638*,m/9638*,n/9638*,q/!Q,,%/ ~\,,(/ ~\,,(/!Qb, ,(/ *,e,'/9638*,/9638*,/!Ja,,./!xG,</!xG,</!a,&,0/!a,',0/!a,(,0/!a,),0/!MG,;/!Ja,%,6/+,-,%/+,-,&/+,-,'/+,-,(/+,-,)/+,-,*/+,-,,/+,-,./!.,C,:/!/0,@/!1,1,@/!.,C,B/!/0,C/2,",C/!a,&,>/!a,',>/!a,(,>/!a,),>/!xG,</!xG,</!a,&,J/!a,',J/!a,(,J/!a,),J/!MG,;/!Ja,%,P/+,-,%/+,-,&/+,-,'/+,-,(/+,-,)/+,-,*/+,-,,/+,-,./!.,C,T/!/0,Z/!1,1,Z/!.,C,\/!/0,]/2,",]/!a,&,X/!a,',X/!a,(,X/!a,),X/!xG,</!xG,</!a,&,d/!a,',d/!a,(,d/!a,),d/!MG,;/!Ja,%,j/+,-,%/+,-,&/+,-,'/+,-,(/+,-,)/+,-,*/+,-,,/+,-,./!.,C,n/!/0,t/!1,1,t/!.,C,v/!/0,w/2,",w/!a,&,r/!a,',r/!a,(,r/!a,),r/!xG,</!xG,</!a,&,~/!a,',~/!a,(,~/!a,),~?"$%)*+%&&&,'./.57ADECB@:>IOQ[^_]\ZTXcikuxywvtnr}i9+*. 4049638. 49638. 4963849638 A 4A49638 A 496384V7 @ `?'//#96389638/ Z\,/!W,/ Z\,/!W,/ Z\,? 3,&( B9638!963849638 963896389638 B963896389638 79638 9638@0`?'//#96389638,/!yk,/963896389638 ,/963896389638 ,?% !"#$%&'()*+/0123456789x_$~}|{zvo =t!#6 +x.!L849638.!O4A6+x.!L849638-!.!O6+w.!L849638 A!>-y - .v 9638.6 +v.!L849638 A!>.wZ-!Z63+5.!L849638 A!>.!J49638!Q.963896386+9638 B9638 496383+%.96389638 6+ 3+%6>+#.!O496383+%- U9638 7 ,,,"49638 !.9638%9638 6&+)3+0.9638%6)+.%-!Z+3+0- U9638 7 ,(,-49638 ,3+260+43+57=.!L849638 A!>5.w6Z-!Z768+;3+\.!L849638 A!>;.!J<49638!Q.9638=96386?+D=9638 B9638 >A496383+L.9638=9638 6D+G3+L6>+J.!O=496383+L- U9638 7 ,C,F,IB49638 H.9638L9638 6M+P3+W.9638L6P+UL-!ZR3+W- U9638 7 ,O,T49638 S3+Y6W+[3+\7=.!L849638 A!>\.O]4Q6^+a7^.!L849638 A!>a.9638b6c+kb S49638 (9638 @49638e.!j!f S49638$963849638ge.   h3+o6>+m3+o- U9638 7 ,j,li S49638 (9638 @496384Q.!j!p S49638$963849638q4Q.   r.!Oos7t7=7=7=+x@%@@@@@@@@@@@963896389638 9638 9638 @@@@@@@@@963896389638 9638 9638 @@@@@@@@(9638 9638$%%(9638 9638$%@@@@+x0p`00p`0@0pp``00p`p`p```p`@`pp``p`pp`@`p`@``0pp``00p`p`p```p`@`pp``p`pp`@`p`@``0p``0p`ppp```@`pppp````?+*'//#96389638,(/!Ja,%/!Qa,/!Ja,%/!^W/!Qb, /!Ja,%/!MW/!Ja,%/!MW/!kn,#/!Ja,%/!MW/!vh,/!Qa,/!kn,#/!Ja,%/!MW/!kn,#/!Ja,%/!MW/!vh,/!Qa,,/!kn,#,/!Ja,%/!MW/!Ja,%/!MW/!9638],-/!`,,/!Y,,/!Y,:,/!,,/ \,,/ \,,"/!9638],-/!Y,,$/!Y,:,%/!,,%/ \,,$/ \,,(/!Qb, ?    !#&'$)*H=66+ S49638)(&@49638*8. j .!O6 B9638+!9638,-!U7 S49638-9638.(&49638*333!9638 B9638/ 9638. O V-96380Z6+7 96381.!L496382 A!>.96383963846+/96384.!L4y $.!L496385.!q S496386(&@49638*. j .!j.!X. j(&. j .! . j(&!.!L4J. j ".!O$6%+* B9638+!9638,-!U'7 S4963879638.(&%49638*"##"3+, &3+.3+1-3+1 ,.,0*/ B96388!9638919638:_-% 49638 49638 A 4A342963875!9638 B9638/79638. O8V-96380Z96:+b896381.!L<496382 A!>=.96383>963846?+Z>96384.!LA4y $B.!LA496385.!qD S496386(&@49638*B. j F.!jE.!XGH. j(&I. j J.!K. j(&L.!LA4J. j M.!OO6P+U B9638+!9638,-!UR7 S4963879638.(&%49638*MNNM3+W &C3+Y3+\->3+\ ,Y,[UZ B96388!96389\9638:_-% 49638 49638 A 4A^_]96387`.O849638 6b+f 49638 7d.O849638 6f+j 49638 7h.O8496386j+m749638.O8496386m+q 496387o.O8496386q+u 496387s.O8496386u+} B9638;963849638 B9638;963849638 B9638;963849638 A Fw9638x9638 A }!P Fzy7{.O8496386}+ 496387.O8496386+ 496387.O8496386+ 49638 49638 A F9638!9638"7.O849638#6+ 49638$7.O849638%6+ 49638&7 B9638<!9638=9638'8 B9638>I7+(&@9638?@@@@9638@96381@96381'963849638496384@%%(&(&(&%@9638?@@@@ @9638@96381@96381'963849638496384@%%(&(&(&%@9638?@@@@ @@ @@ @@@@ @@ @@  9638A9638B9638C9638D@@ @@ @@ 9638A@@ @@ @@+pp`xX````00p`ppp`pppppppppppppp`xX`````ppp `00p`ppp`pppppppppppppp`xX`````ppp `p`p`p`p`p``p`p`p`p`p`pP`p`p`p`p`p`ppp`p`p`p`p`P`?+'//#96389638(,</#96389638(,=/#96389638(,=/#96389638(,>/#96389638(,?/#96389638(,@/#96389638(,@/#96389638(,A/#96389638(,B/#96389638(,C/#96389638(,D/#96389638(,E/#96389638(,F/#96389638(,G/#96389638(,H/#96389638(,I/#96389638(,J/#96389638(,K/#96389638(,O/#96389638(,Q/#96389638(,R/#96389638(,S/#96389638(,W/#96389638(,Y/#96389638(,Z/#96389638(,[/#96389638(,\/#96389638(,]/#96389638(,^/#96389638(,_/#96389638(,`/#96389638(,a/#96389638(,b/#96389638(,c/#96389638(,d/#96389638(,e/#96389638(,f/#96389638(,g/#96389638(,i/!y2,/!,b,(/!Y,9,)/!,S,)/!,T,)/!,U,)/!Q,,,/ ~\,,./!Qb, ,./!`W,!,-/!YW,#,-/!9638,/!9638,,3/!9638,,3/!M,/!Ja,%,6/!MW,6/!k,B/!k,C/!k,D/!k,E/!Ja,%,:/!Ja,%,;/!XT,W,;/! ,p,;/! ,o,@/!Y,;,A/ \,,@/ \,,C/!X,,@/ ~\,,E/!T,*,E/!T,o,E/!*W, ,E/!N,,I/ o\, ,J/![,,@/ ~\,,L/!T,*,L/!T,o,L/!*W, ,L/!N,,P/ o\, ,Q/!Ja,%,;/!,O,;/!,P,;/!,Q,;/!Q,,U/ ~\,,W/!Qb, ,W/!`W,!,V/!`W,,V/!YW,#,V/!YW,",V/!9638,O/!9638E,O,^/ \,w,_/!9638,/!9638,,a/!9638,,a/!M,/!Ja,%,d/!MW,d/!k,B/!k,C/!k,D/!k,E/!Ja,%,h/!Ja,%,i/!XT,W,i/! ,p,i/! ,o,n/!Y,;,o/ \,,n/ \,,q/!X,,n/ ~\,,s/!T,*,s/!T,o,s/!*W, ,s/!N,,w/ o\, ,x/![,,n/ ~\,,z/!T,*,z/!T,o,z/!*W, ,z/!N,,~/ o\, ,/!Ja,%,i/!,O,i/!,P,i/!,Q,i/!Q,,/ ~\,,/!Qb, ,/!`W,!,/!`W,,/!YW,#,/!YW,",/!9638,O/!9638E,O,/ \,w,/!yk,,'?*/0,,,,-3578=;>?BFGEKMLRSXYUUUUV;<_acefkilmptusy{zij  !!"""##$%%&&''- .!m86.!m8¯3? =6?.9638j963887 B9638963896384963887@@@9638@@p`p`pp`pp`@`?'//#9638,/#9638,/!fT,/!fT,/!N]?638.9638f6 I.9638f3 I=63.96389638496389638.9638N$.9638j  7 ?/#9638,/#9638,? #self#x*|. 496388 A 4A4w496387 @ `?'//#9638^/!W,/ Z\,?=LMN  w+0.4C.P4.   9638-!. +?.  . &6 B 473. j ~3333 S4@4  33+-!.!r6+(.!. +?.  . &6+ B 473+ . j ~3+"3+#3+$3+% S4@4  3+'3+?.!O-!Z(6)+?.!r6++/ B!  7.!. /+?.  0. 1&62+6 B 4/73+7. j ~/3+93+:3+;3+< S4@4773+>?3+@9638-!@. A+?.  B. C&6D+H B 4A73+I. j ~A3+K3+L3+M3+N S4@4@II3+P3+Q-!@.!rQ6R+d.!Q. T+?.  U. V&6W+[ B 4T73+\. j ~T3+^3+_3+`3+a S4@4@\\3+c3+{.!OQ-!Zd6e+{.!r6g+k B!  7.!Q. k+?.  l. m&6n+r B 4k73+s. j ~k3+u3+v3+w3+x S4@4@ss3+z?3+|9638-!|. }+?.  ~. &6+ B 4}73+. j ~}3+3+3+3+ S4@4|3+3+-!|.!r6+.!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@4|3+3+.!O-!Z6+.!r6+ B!  7.!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@4|3+?3+9638-!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@43+3+-!.!r6+.!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@43+3+.!O-!Z6+.!r6+ B!  7.!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@43+?3+9638-!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@43+3+-!.!r)6)+.!). )+?.  ) . ) &6) + B 4)73+. j ~)3+3+3+3+ S4@4))3+3+/.!O)-!Z)6)+/.!r6)+ B!  7.!). )+?.  ) . )!&6)"+& B 4)73+'. j ~)3+)3+*3++3+, S4@4)')'3+.?3+07?+0($$%' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@@+0Pp00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@``00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@``00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@``00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@``00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@```?+<'//#96389638 ,b/#96389638 ,c/#96389638 ,g/#96389638 ,h/#96389638 ,i/#96389638 ,j/#96389638 ,k/#96389638 ,l/9638 ,*/ \,/ \,/!9638g,1/!9638g,2/!9638g,3/!^W/!g,9/!`W,/!N]/ ~\,/ \,/ \,/ \,/ \,/ \,/ \,|,/ \,},/ \,~,/!YW,"/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,/!|h,z,/!_T,S,'/![T,V, /!Ng,0, /!`W,,*/!N],+/ ~\,,,/ \,,-/ \,,./ \,,./ \,,./ \,,./ \,|,1/ \,},1/ \,~,1/!YW,",*/!vh,,!/!Qb, ,7/!kn,#,7/!_T,S,"/![T,V,$/!g,9,$/!`W,,</!N],=/ ~\,,>/ \,,?/ \,,@/ \,,@/ \,,@/ \,,@/ \,|,C/ \,},C/ \,~,C/!YW,",</!9638g,1/!9638g,2/!9638g,3/!^W,J/!g,9,J/!`W,,M/!N],N/ ~\,,O/ \,,P/ \,,Q/ \,,Q/ \,,Q/ \,,Q/ \,|,T/ \,},T/ \,~,T/!YW,",M/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,[/!|h,z,\/!_T,S,d/![T,V,]/!Ng,0,]/!`W,,g/!N],h/ ~\,,i/ \,,j/ \,,k/ \,,k/ \,,k/ \,,k/ \,|,n/ \,},n/ \,~,n/!YW,",g/!vh,,^/!Qb, ,t/!kn,#,t/!_T,S,_/![T,V,a/!g,9,a/!`W,,y/!N],z/ ~\,,{/ \,,|/ \,,}/ \,,}/ \,,}/ \,,}/ \,|,/ \,},/ \,~,/!YW,",y/!9638g,1/!9638g,2/!9638g,3/!^W,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,/!|h,z,/!_T,S,/![T,V,/!Ng,0,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!vh,,/!Qb, ,/!kn,#,/!_T,S,/![T,V,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!9638g,1/!9638g,2/!9638g,3/!^W,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,/!|h,z,/!_T,S,/![T,V,/!Ng,0,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!vh,,/!Qb, ,/!kn,#,/!_T,S,/![T,V,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!9638g,1/!9638g,2/!9638g,3/!^W,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|, / \,}, / \,~, /!YW,",/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,/!|h,z,/!_T,S,/![T,V,/!Ng,0,/!`W,,/!N],/ ~\,, / \,,!/ \,,"/ \,,"/ \,,"/ \,,"/ \,|,%/ \,},%/ \,~,%/!YW,",/!vh,,/!Qb, ,+/!kn,#,+/!_T,S,/![T,V,/!g,9,/!`W,,0/!N],1/ ~\,,2/ \,,3/ \,,4/ \,,4/ \,,4/ \,,4/ \,|,7/ \,},7/ \,~,7/!YW,",0? &()555111.*89!:"##;GGGCCC@<%LXXXTTTQMKce\frrrnnnkguv^w_``x}yb   )))%%%",-./;;;77740 je% !"#$%&'()*+-/0123456789x_Q~}|{zvoM5X+ S49638'@%49638'++.!.!r A z.!r633 >=  -!Z 6 + ,  ,  A! =9638.!O63+.!q3+ , , ,>=-!Z6+33+3+3+9638 A! >96389638 A! >9638!9638 A! >9638#9638 A! >9638%9638 A! >9638 '9638 A! >9638 )9638 A! >9638+9638 A! >9638-9638 A! >9638/9638 A! >963819638 A! >963839638 A! >963859638 A! >963879638 A! >963899638 A! >9638;9638! A! >9638 =9638# A! >9638"?9638% A! >9638$A9638' A! >9638&C9638) A! >9638(E9638+ A! >9638*G9638- A! >9638,I9638/ A! >9638.K96381 A! >96380M96383 A! >96382O96385 A! >96384Q96387 A! >96386S96389 A! >96388U9638; A! >9638:W9638= A! >9638<Y9638? A! >9638>[9638A A! >9638@]9638C A! >9638B_9638E A! >9638Da9638G A! >9638Fc9638I A! >9638He9638K A! >9638Jg9638M A! >9638Li9638O A! >9638Nk9638Q A! >9638Pm9638S A! >9638Ro9638U A! >9638Tq9638W A! >9638Vs9638Y A! >9638Xu9638[ A! >9638Zw9638] A! >9638\y9638_ A! >9638^{9638a A! >9638`}9638c A! >9638b9638e A! >9638d9638g A! >9638f9638i A! >9638h9638k A! >9638j9638m A! >9638l9638o A! >9638n9638q A! >9638p9638s A! >9638r9638u A! >9638t9638w A! >9638v9638y A! >9638x9638{ A! >9638z9638} A! >9638|9638 A! >9638~9638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96389638 A! >96387+'%%@@@%%@%%'@@%@%%@@@@@%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'@+00ppp```000p`00p``p`000p`````000000000000000000000000000000000000000000000000000000000000000000000000000000`?+'//#96389638/#96389638/#96389638/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638, /#96389638,!/#96389638,"/#96389638,#/#96389638,$/#96389638,%/#96389638,&/#96389638,'/#96389638,(/#96389638,)/#96389638,*/#96389638,+/#96389638,,/#96389638,-/#96389638,./#96389638,//#96389638,0/#96389638,1/#96389638,2/#96389638,3/#96389638,4/#96389638,5/#96389638,6/#96389638,7/#96389638,8/#96389638,9/#96389638,:/#96389638,;/#96389638,</#96389638,=/#96389638,>/#96389638,?/#96389638,@/#96389638,A/#96389638,B/#96389638,C/#96389638,D/#96389638,E/#96389638,F/#96389638,G/#96389638,H/#96389638,I/#96389638,J/#96389638,K/#96389638,L/#96389638,M/#96389638,N/#96389638,O/#96389638,P/#96389638,Q/#96389638,R/#96389638,S/#96389638,T/#96389638,U/#96389638,V/#96389638,W/#96389638,X/#96389638,Y/#96389638,Z/#96389638,[/#96389638,\/#96389638,]/#96389638,^/#96389638,_/#96389638,`/#96389638,a/!9638g,F/!9638g,H,Q/!9638g,H,Q/!9638g,H,Q/ \,,R/ \,,U/!g,,S/!g,,S/!g,,S/!g,,S/!g,,S/!g,,S/!u,A,Y/!u,,]/!u,`,^/!u,a,^/!u,b,^/!pg,,a/!c,#,a/!Mc,,c/!t,,c/!t,,e/!t,,f/!t,,f/!t,,f/!t,,f/!b,,j/!_T,S,k/!zW,,k/!Mc,,^/!Pt,,Y/!et,,o/!t,G,p/!Ja,%,q/!N],q/!|h,z,p/!_T,S,t/!xg,,Z/!Pt,,[/!Pt,,[/!Pt,,[/!Pt,,[/!Pt,,[/!t,G,y/!Ja,%,|/!N],|/!Qb, ,y/!XT,W,z/!N],z/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,/!xg,,/!xg,,/!xg,,/!xg,,/!xg,,/!xg,,/!xg,,/!xg,,/!xg,,/!xg,,/!xg,,/!xg,, /!xg,,!/!xg,,"/!xg,,#/!xg,,$/!xg,,%/!xg,,&/!xg,,'/!xg,,(/!xg,,)/!xg,,*/!xg,,+/!xg,,,/!xg,,-/!xg,,./!xg,,//!xg,,0/!xg,,1/!xg,,2/!xg,,3/!xg,,4/!xg,,5/!xg,,6/!xg,,7/!xg,,8/!xg,,9/!xg,,:/!xg,,;/!xg,,</!xg,,=/!xg,,>/!xg,,?/!xg,,@/!xg,,A/!xg,,B/!xg,,C/!xg,,D/!xg,,E/!xg,,F/!xg,,G/!xg,,H/!xg,,I/!xg,,J/!xg,,K/!xg,,L/!xg,,M/!xg,,N/!xg,,O?VblmuoYYYYYYYvyy[[[[[[\  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP" ?S][ +.!O8&63+.!O8&63+.!O8&63+.!O8&6 3+.!O8& 6 3+.!O8& 63+ B9638963896384963887.9638j963887+@@@@@@@@@@@@@9638@+p``p``p``p``p``p``@`p`?'//#9638,/#9638,/!Qb, /!Qb, /!Qb, /!Qb, /!Qb, /!Qb, /!N]?638e+.9638Q&63.9638Q&63.9638Q&63.9638Q&6 3.9638Q& 6 3.9638Q& 63.96389638496389638.9638N&.9638j7++?/#9638,/#9638,? #self#x% !"#$%&'()*+/0123456789x_$~}|{zvo  R963888=879638@p`?'//#96389638,[/#96389638,V?% !"#$%&'()*+./0123456789x_W~}|{zvo. .!m86.!m8®3? =6?.9638j963887 B9638963896384963887@@@9638@@p`p`pp`pp`@`?'//#9638,/#9638,/!fT,/!fT,/!N]?638.9638f6 I.9638f3 I=63.96389638496389638.9638N$.9638j  7 ?/#9638,/#9638,? #self#xOopqrs=tuvwxyz{|}~0V6O!+  A 4A4 49638 ,  B9638 8.!m6+  B9638 96389638$8.OV6+p B9638 8.!L49638.!m 6 3.!3   R963833.!r6+3+k6>+<.!r6+3+-.!r6+ B9638!9638-!U73+!.!m6!+,.!r6#+( B9638!9638-!U%73+)- 8.!m)3+-3+- ,,+,,*=6-+03+3 B9638!A8-!U07 B9638!9638863+: B9638!9638865+83+< B9638!963887 B9638!963887 B9638!96388.!<.!=.!q>. ?+?.  @. A&6B+F B9638 4?73+G. j ~?3+I3+J3+K S49638963849638G3+M $8K S49638(&@49638K S49638(&@496388. j O.!j.!XPQ. j(&R. j S.!T. j(&U.!;?. W+?.  X. Y&6Z+^ B9638 4W73+_. j ~W3+a3+b3+c3+d.!jN.!jV S4963849638de__VN3+h3+i &M3+k ,,jGK S49638 @49638 -! A! = km3+ %.!rp6q+.!L49638% B9638!!96388t.!mu6v+y3+{.!3+{ ,x,zuy R9638{3+~3+.!r{6+3+6>+.!r{6+3+.!r{6+ B9638!9638-!U73+.!m6+.!r{6+ B9638!9638-!U73+- 8.!m{3+3+ ,,,=6+3+ B9638!A8|-!U7 B9638!963886+ B9638!96388{6+3+ B9638!96388{7 B9638!963887 B9638!96388{.!.!.!q. +?.  . &6+ B9638 473+. j ~3+3+3+ S496389638496383+ $8 S49638(&@49638 S49638(&@496388. j .!j.!X. j(&. j .!. j(&.!;. +?.  . &6+ B9638 473+. j ~3+3+3+3+.!j.!j S49638496383+3+ &3+ ,,G S49638 @49638s-!s A! =s% B9638!96388 B9638"9638#9638$ B9638%9638#9638&849638'.!L.!L6>+.!w!Z6+ .!L49638(.!O4I3+3+ ,,=6+ .!J49638.!M.9638#w9638#6+-9638#9638) ,,-9638#U73+3+9638.9638*6+ B9638+3+-96383+ ,,.w6+.!L49638- F) A }!P))3+ .!L49638 S49638 @49638)-!) A! =))3 A 4F4963849638 A 49638 ) 7) +  %%@%@%@@%@%9638@@@@@@@@9638,@@@@9638,@@%@@@@9638-@@@@@@%%%%%&@@@@@@@@(&(&(&(&%%&@@@@@@@@@@@%@%@%%@@%@%9638@@@@@@@@9638,@@@@9638,@@%@@@@9638-@@@@@@%%%%%&@@@@@@@@(&(&(&(&%%&@@@@@@@@@@@%%%9638.@%@@ @@@ @@@@@@@@9638/@@@@96380@@%@ @+  pp`p`0p``p`p0``p```p``p`xX``p`p`xX``pp``p``xX````P`P`pppppp`P``p```0`ppppppppppp`P``p````pp```p@0 `pp`0pp``p`p0``p```p``p`xX``p`p`xX``pp``p``xX````P`P`pppppp`P``p```0`ppppppppppp`P``p````pp```p@0 pppp`p`p0p``p`pHHxhpHpX```0p`p``pp`0pp`0@0 ` `?+['//#9638 9638 ,$/#9638 9638 ,%/#9638 9638 ,&/#9638 9638 ,'/#9638 9638 ,(/#9638 9638 ,)/#9638 9638 ,*/#9638 9638 ,+/#9638 9638 ,,/#9638 9638 ,-/#9638 9638 ,//#9638 9638 ,0/#9638 9638 ,2/#9638 9638 ,3/#9638 9638 ,4/#9638 9638 ,5/#9638 9638 ,6/#9638 9638 ,7/#9638 9638 ,8/ \,w/ Z\,/!fT,/!Ja,%/!t/!t,,/!t,,/!h,,/!fT,,/![T,V,/!N],/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!et,, /!t,B,+/!Ja,%,,/!N],,/!t,G,+/!Ja,%,//!N],//!|h,z,+/!_T,S,2/!t,B,!/!Ja,%,4/!N],4/!t,G,!/!Ja,%,7/!N],7/!.#,,#/!.#,,:/!et,,;/!t,B,</!Ja,%,=/!N],=/!t,G,</!Ja,%,@/!N],@/!|h,z,</!_T,S,C/!96381t,K,;/!et,,E/!t,B,F/!Ja,%,G/!N],G/!t,G,F/!Ja,%,J/!N],J/!|h,z,F/!_T,S,M/!t,B,E/!Ja,%,O/!N],O/!fT,,;/!96382t,L,;/!et,,S/!t,B,T/!Ja,%,U/!N],U/!t,G,T/!Ja,%,X/!N],X/!|h,z,T/!_T,S,[/!t,G,S/!Ja,%,]/!N],]/!J,r,;/!fT,,;/!,,&/![T,V,&/![T,V,'/!XT,W,'/!96383,Z,(/!N],f/ ~\,,g/ \,,h/ \,,i/ \,,i/ \,,i/ \,,i/ \,|,l/ \,},l/ \,~,l/! ,o,)/!Y,;,q/! ,p,)/! ,o,s/!Y,;,t/ \,,s/ \,,v/!X,,s/ ~\,,x/!T,*,x/!T,o,x/!*W, ,x/!N,,|/ o\, ,}/![,,s/ ~\,,/!T,*,/!T,o,/!*W, ,/!N,,/ o\, ,/!96384g,,)/!96384g, ,)/!96384g,!,)/!sT,X,/!963896385,,/!963896385,,/!`W,!,/!`W,!,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,$,/!N,,/!YW,$,/!N,,/!YW,",/ \,w/!g,e/!g,f/!g,g/!g,h/!Ng,0,/!^W,/!96386g,,/!Na,S,/!|h,z/!_T,S,/!Ja,%/!9638#,/!t/!t,,/!t,,/!h,,/!fT,,/![T,V,/!N],/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!M,/!et,,/!t,B,/!Ja,%,/!N],/!t,G,/!Ja,%,/!N],/!|h,z,/!_T,S,/!t,B,/!Ja,%,/!N],/!t,G,/!Ja,%,/!N],/!.#,,/!.#,,/!et,,/!t,B,/!Ja,%,/!N],/!t,G,/!Ja,%,/!N],/!|h,z,/!_T,S,/!96381t,K,/!et,,/!t,B,/!Ja,%,/!N],/!t,G,/!Ja,%,/!N],/!|h,z,/!_T,S,/!t,B,/!Ja,%,/!N],/!fT,,/!96382t,L,/!et,,/!t,B,/!Ja,%,/!N],/!t,G,/!Ja,%,/!N],/!|h,z,/!_T,S,/!t,G,/!Ja,%,/!N],/!J,r,/!fT,,/!,,/![T,V,/![T,V,/!XT,W,/!96383,Z,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/! ,o,/!Y,;,/! ,p,/! ,o,/!Y,;,/ \,,/ \,, /!X,,/ ~\,, /!T,*, /!T,o, /!*W, , /!N,,/ o\, ,/![,,/ ~\,,/!T,*,/!T,o,/!*W, ,/!N,,/ o\, ,/!96384g,,/!96384g, ,/!96384g,!,/!sT,X,/!963896385,,/!963896385,,/!`W,!,/!`W,!,/!`W,,/!N],!/ ~\,,"/ \,,#/ \,,$/ \,,$/ \,,$/ \,,$/ \,|,'/ \,},'/ \,~,'/!YW,$,/!N,,,/!YW,$,/!N,,./!YW,",/ \,w/!g,e/!g,f/!g,g/!g,h/!Ng,0,3/!^W,4/!96386g,,4/!Na,S,8/!,/9638#96387,/9638#9638896387,,;/9638#9638896387,,;/9638#9638896387,,;/9638#9638896387,,;/9638#9638896387,,;/9638#9638896387,,;/9638#9638896387,,;/9638#9638896387,,;/!lc,\,=/!lc,\,D/!XT,W,E/!lc,\,=/!XT,W,G/!96389,&,>/!Ja,%,I/!lc,\/!lc,\,K/!XT,W,L/!lc,\/!XT,W,N/!Ja,%/!Ja,%/!g,e/!g,f/!g,g/!g,h/!Ng,0,S/!^W,T/!96386g,,T/!Na,S,X/ Z\,/ Z\,?3 "D;NEEEER;\SSSS`a:::::$$%%%%$$bcdeppplllif)ruyzx~)*    +++'''$-/ 678 :==EG>IIIJI>>???@@AABBBC;PQVWXZ[lmnJ:jki+|. 496388 A 4A4w496387 @ `?'//#9638^/!W,/ Z\,?xhdefg~qcWXYZ[\H]^_`abS/C LUV% " !"#$%&'()*+ST./0123456789x_~}|{zvoR !OPQ=LMN  -+.4C.P4.   9638-!. +?.  . &6 B 473. j ~3333 S4@4  33+-!.!r6+(.!. +?.  . &6+ B 473+ . j ~3+"3+#3+$3+% S4@4  3+'3+?.!O-!Z(6)+?.!r6++/ B!  7.!. /+?.  0. 1&62+6 B 4/73+7. j ~/3+93+:3+;3+< S4@4773+>?3+@9638-!@. A+?.  B. C&6D+H B 4A73+I. j ~A3+K3+L3+M3+N S4@4@II3+P3+Q-!@.!rQ6R+d.!Q. T+?.  U. V&6W+[ B 4T73+\. j ~T3+^3+_3+`3+a S4@4@\\3+c3+{.!OQ-!Zd6e+{.!r6g+k B!  7.!Q. k+?.  l. m&6n+r B 4k73+s. j ~k3+u3+v3+w3+x S4@4@ss3+z?3+|9638-!|. }+?.  ~. &6+ B 4}73+. j ~}3+3+3+3+ S4@4|3+3+-!|.!r6+.!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@4|3+3+.!O-!Z6+.!r6+ B!  7.!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@4|3+?3+9638-!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@43+3+-!.!r6+.!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@43+3+.!O-!Z6+.!r6+ B!  7.!. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@43+?3+7?+($$%' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@' %%&@@@@@@@@@%@%%&@@@@@@@@@@@@%%&@@@@@@@@@@+Pp00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@``00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@``00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@``00ppp`P``p````@``0p`pppp`P``p````@``pp`p`P`pppp`P``p````@```?+'//#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/9638 ,*/ \,/ \,/!9638g,1/!9638g,2/!9638g,3/!^W/!g,9/!`W,/!N]/ ~\,/ \,/ \,/ \,/ \,/ \,/ \,|,/ \,},/ \,~,/!YW,"/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,/!|h,z,/!_T,S,%/![T,V,/!Ng,0,/!`W,,(/!N],)/ ~\,,*/ \,,+/ \,,,/ \,,,/ \,,,/ \,,,/ \,|,// \,},// \,~,//!YW,",(/!vh,,/!Qb, ,5/!kn,#,5/!_T,S, /![T,V,"/!g,9,"/!`W,,:/!N],;/ ~\,,</ \,,=/ \,,>/ \,,>/ \,,>/ \,,>/ \,|,A/ \,},A/ \,~,A/!YW,",:/!9638g,1/!9638g,2/!9638g,3/!^W,H/!g,9,H/!`W,,K/!N],L/ ~\,,M/ \,,N/ \,,O/ \,,O/ \,,O/ \,,O/ \,|,R/ \,},R/ \,~,R/!YW,",K/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,Y/!|h,z,Z/!_T,S,b/![T,V,[/!Ng,0,[/!`W,,e/!N],f/ ~\,,g/ \,,h/ \,,i/ \,,i/ \,,i/ \,,i/ \,|,l/ \,},l/ \,~,l/!YW,",e/!vh,,\/!Qb, ,r/!kn,#,r/!_T,S,]/![T,V,_/!g,9,_/!`W,,w/!N],x/ ~\,,y/ \,,z/ \,,{/ \,,{/ \,,{/ \,,{/ \,|,~/ \,},~/ \,~,~/!YW,",w/!9638g,1/!9638g,2/!9638g,3/!^W,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,/!|h,z,/!_T,S,/![T,V,/!Ng,0,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!vh,,/!Qb, ,/!kn,#,/!_T,S,/![T,V,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!9638g,1/!9638g,2/!9638g,3/!^W,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!ig, /!ig,!/!ig,"/!ig,#/!ig,$/!ig,%/!ig,&/!ig,(/!ig,*/!^W,/!|h,z,/!_T,S,/![T,V,/!Ng,0,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!vh,,/!Qb, ,/!kn,#,/!_T,S,/![T,V,/!g,9,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",?   $&'333///,(678 !!9EEEAAA>:#JVVVRRROKIacZdpppllliest\u]^^v~~~{w`:IJKHC <=>?@ABCDEFG"Syx8(;$:" !"#$%&'()*+,-./0123456789x_~}|{zvo D?:984*%h+ B!9638.!j(. j .!O-!Z6+ B!9638.!j(. j .!O 6 B96387.!j(&. j .!O6+ B!-!U7 S4(&4 3+3+3+3+ R 9638= B ! 4 44.!j.!-!.!m.!j.! .!!6"+' A!=.!q3+(3+( ,&,'=> ,&$ ,&%3+,-!Z(6,+ ,-,) ,-,*- 9638.!L.4J.!r1062+53+L- 9638 $.9638.!L.4y S4(&@4 7.!L.4. j 8.!j9.!X:;. j(&< S4(&@4 9638.!j5.!j=.!j> S4$4 @A??>=.! %B &6.!OC6E+K B!.0.!q0.!OGH3+L3+L ,4,J,K=I=6L+.!L.4J B!.N.!mO6P+S3+T3+T ,R,SO3+V3+W6>+|.!mT6X+|.!mT6Z+]3+^3+^ ,\,]T R ^3+a3+b.!r^6b+e3+u.!r^6e+j B!-!Ug73+k.!r^6k+p B!-!Um73+q.!L.4J.!m^q3+u? ,d,sbr6u+x3+{ B!A._-!Ux7?.!L.4y.!L.4.!q}.!L.4.!qT B|~3+3+3+3+? ,,.9638.!L4y $.!L4.!q S4(&@4 . j .!j.!X. j(&. j .!. j(&.!L4J. j .!O6+ B!-!U7 S4(&%4 3+ &3+3+ S4@4 -! A! =3+.!j/.!-!.!m.!j.!.!6+ A!=/.!q/3+3+ , , ,,=>-!Z6+3+.7?+(@(@@(&@@@@@@ '%@%@@%@@%%%@@%@(&%(&(&$%@@%%@@@%%@@@%@@@@@@@% @@@@@@@@@@%@@@@%%%%@@@@'@%%(&(&(&%@@@@@@%'@%@%@@%@@@+pppp`ppp`P`ppp`xX`````ppp0pppp`p``000`p`00ppp``pppppppppppp`pp``p`pp```p```p`p```pp``p``p`xX``p`xX``pp`0p``xX`ppppp````pp0ppppppppppppp`xX````@0 `pp0pppp`p``000p```?+'//#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/!6/!7 ,/!! ,9/!vh,/!Q,/! ,/!N,/!o,/!Q,/ ~\,/!Qb, /!kn,#/!M ,/!" ,;/!" ,</!" ,=/!Q,,/! ,,/!N,,/!o,,/!Q,,/ ~\,,/!Qb, ,/!,,/!N,,/!o,,/!,S,/!,T,/!,U,/!Q,,!/ ~\,,#/!Qb, ,#/!`W,!,"/!YW,#,"/!9638,r/!#,r,(/!#,t,(/!$,G,*/!%,G,+/!&,,,/!g,,*/!Pg,/!Pg,,//!T,*,0/![T,(,0/![T,),0/![T,*,0/![T,+,0/![T,,,0/!T,o,4/!T,*,4/![T,V,6/!^W,0/!_T,,0/!h,,;/!fT,,</!W, ,;/!W,C,>/!W,D,>/!W,E,>/!W,H,>/!_T,,;/!n,&,;/!MW,0/!XT,W,0/!9638,:/!9638,</!9638,=/!9638,>/!9638,?/!9638,@/!9638,B/!J,r,H/!Jk,H,I/!Ja,%,O/!_T,S,I/!a,,K/!',,K/!',,K/!',,K/!',,K/!',,K/!Yk,z,U/!Yk,{,U/!Ja,%,Y/! ,o,Y/!Y,;,[/!N,,Y/!Ja,%,Y/!X,,Y/ ~\,,_/!T,*,_/!T,o,_/!*W, ,_/!N,,c/ o\, ,d/!Y,;,V/!T,*,W/!(,3,W/!(,4,W/!`W,!,i/!`W,!,i/!T,o,i/!`W,,i/!YW,$,i/!N,,n/!YW,$,i/!N,,p/!YW,",i/!T,%,i/!T,o,W/!Qb, ,K/!k,h,L/!XT,W,L/!Qb, ,L/!#,/!Jk,H,y/!Ja,%,z/!t/!t,,|/!t,,}/!h,,~/!fT,,/![T,V,~/!N],~/!Mk,$/!)k,+,/!t,G,/!Ja,%,/!N],/!)k,-,/!)k,.,/!)k,/,/!fT,,/!t,/!t,,/!t,,/!h,,/!fT,,/![T,V,/!N],/!.#,,/!.#,,/!et,,/!t,B,/!Ja,%,/!N],/!t,G,/!Ja,%,/!N],/!|h,z,/!_T,S,/!*t,K,/!et,,/!t,B,/!Ja,%,/!N],/!t,G,/!Ja,%,/!N],/!|h,z,/!_T,S,/!t,B,/!Ja,%,/!N],/!fT,,/!+t,L,/!et,,/!t,B,/!Ja,%,/!N],/!t,G,/!Ja,%,/!N],/!|h,z,/!_T,S,/!t,G,/!Ja,%,/!N],/!Jk,H,/!Ja,%,/!fT,,/!Ja,%,/!Ja,%,/!XT,W,/!Ja,%,/!XT,W,/!)k,),/!g,\/!g,^/!g,_/!g,`/!g,a/!N#,,/!k,B,/!k,C,/!k,D,/!k,E,/!Ja,%,/!Ja,%,/!XT,W,/! ,p,/! ,o,/!Y,;,/ \,,/ \,,/!X,,/ ~\,,/!T,*,/!T,o,/!*W, ,/!N,,/ o\, ,/![,,/ ~\,,/!T,*,/!T,o,/!*W, ,/!N,,/ o\, ,/!Ja,%,/!,O,/!,P,/!,Q,/!Q,,/ ~\,,/!Qb, ,/!`W,!,/!`W,,/!YW,#,/!YW,",/!Ng,0,/!^W,/!,g,,/!NW,A,/!Pg,/!T,*,/![T,(,/![T,),/![T,*,/![T,+,/![T,,,/!T,o,/!T,*,/![T,V,/!^W,/!_T,,/!h,,/!fT,,/!W, ,/!W,C,/!W,D,/!W,E,/!W,H,/!_T,,/!n,&,/!MW,/!XT,W,? $%!!!!"-.19:=ACD0EF///NPQIRTZ\^`a_efgoqisWuKvwx{y~}  3,&( B9638!963849638963896389638 B963896389638 79638 9638 @0`?'//#96389638,/!yk,/963896389638 ,/963896389638 ,? K  ^t/I  @ @(@ 638Q R96387?/#96389638?#ctor-self#lockentries`  R96388879638@0`?'//#96389638?638[ R96387?/#96389638,V?(#ctor-self#maskpatskipwscontenttypeh  R9638888879638@0`?'//#96389638,V?h  R9638888879638@0`?'//#96389638,V?g+%?. L84???? B63? 4 4 B  88 .!L .!L 6>+#.!w !Z6+ .!L4 .!O4I3+3+ ,,=6+# .!J4.!M.w6+ - ,,-U 7. F 3+%7#+%@@@%@@ @@@ @@@@@@@@+%ppppppp``pppp`p`p0p``p`pHHxhpHpX`p``?'//#,/#,/#,/#,/#,/#,/#,/#,/#,/!lc,\/!lc,\/!XT,W/!lc,\/!XT,W/!,&/!Ja,%?  9N+1-8-96388. +?.  . &6 B9638 473. j ~3333 S49638@496388  3.m63+3+ 3+3+.r6+3+3+ ,,>= , ,-Z6+1 , ,0+ , ,0, AL8!=.q! A =8#$.O"6&+)3++.q"3++ ,*) ,*) ,(,*>=-Z-6.+13+!78+1%%%&@@@@@@@@@@@%@@@@@%%@%%@%@@%@%%@@@+10pppp`P``p````@`p```p``p```000p`00pp p``p`000p```?+='//!g,k/!g,l/!g,m/!g,n/!g,o/!g,p/!g,q/!g,r/!^W/!^c,/!Ng,0/!`W,/!N]/ ~\,/ \,/ \,/ \,/ \,/ \,/ \,|/ \,}/ \,~/!YW,"/!t/!t,,/!t,,/!h,,/!fT,,/![T,V,/!N],/!Pt,/!et,,/!t,B, /!Ja,%,!/!N],!/!t,G, /!Ja,%,$/!N],$/!|h,z, /!_T,S,'/!t,B,/!Ja,%,)/!N],)/!t,B,/!Ja,%,,/!N],,/!c,!/!XT,W/!g,/!Na,S,1/!Pt,/!Pt,/!Pt,/!Pt,/!Pt,/!t,G,5/!Ja,%,8/!N],8/!Qb, ,5/!XT,W,6/!N],6?  (/01;55<. 78@`?'//!W,?Q d B96387@@@P`?'//!b,P? d.63.963863.96383 963896387 @@@@p``p```p`?'//!b,M? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u?b( A }P8- F A }PM87@@@p`?'//!g,/!g,? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u? @. 78@`?'//!W,?Q d B96387@@@P`?'//!b,P? d.63.963863.96383 963896387 @@@@p``p```p`?'//!b,M? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u? . 78@`?'//!W,?Q d B96387@@@P`?'//!b,P? d.63.963863.96383 963896387 @@@@p``p```p`?'//!b,M? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u? A }P8.63.963863.96383 963896387 @@@@p``p```p`?'//!b,u?  S4'9638@%4'9638?7'9638@0p`?'//!Mg,/!Mg,/!Mg,/!Mg,/!Mg,/!Mg,/!Mg,/!Mg,/!Mg,/ \,? O  R96388879638@0`?'//!_u, ?F .L8879638@P`?'//!Ja,%? +.L84.j.-.m.j..6 A=.q33 =>   367V-9638. F7+%@@%@@@%@@@ @+ppp0pppp`p``000``` p`?+ '//!Pu,+/!Pu,,/!Pu,-/!Pu,./!Pu,//!Ja,%/!Pg,/!Pg,/!T,*/![T,(/![T,)/![T,*/![T,+/![T,,/!T,o/!T,*/![T,V/!^W/!_T,/!h,/!fT,/!W, /!W,C,/!W,D,/!W,E,/!W,H,/!_T,/!n,&/!MW/!XT,W/!Mc,/!Mc,?  +.L84. L8.j.-.m.j..6 A=.q33 =>   67V-9638. F7+%%@@%@@@%@@ @+pppp0pppp`p``000`` p`?+'//!Pu,+/!Pu,,/!Pu,-/!Pu,./!Pu,//!Ja,%/!Pg,/!T,*/![T,(/![T,)/![T,*/![T,+/![T,,/!T,o/!T,*/![T,V/!^W/!_T,/!h,/!fT,/!W, /!W,C,/!W,D,/!W,E,/!W,H,/!_T,/!n,&/!MW/!XT,W/!Mc,/!Mc,?+:.L84.j.-.m.j..6 A=.q33 =>   363+-96383+ ,>= , , ,,85 ,,87 ,,86-Z6+9V6+!7.L84.j."-!.m$.j$.#&.%'6(+- A=!.q3+.3+. ,,,-=> ,,* ,,+6.+33+5-9638/3+5 ,2,4>= ,40 ,433+-UV7+:%@@%@@@%@@@ @ % %@@@%@@%@@@%@@ @% @@+:ppp0pppp`p``000``` `000000p`0@`ppp0pppp`p``000`` `000`X`?+J'//!g,/!g,/!g,/!g,/!g,/!g,/!g,/!g,/!Pu,*/!Pu,+/!Pu,,/!Pu,-/!Pu,./!Pu,//!Ja,%/!Pg,/!Pg,/!T,*/![T,(/![T,)/![T,*/![T,+/![T,,/!T,o,/!T,*,/![T,V,/!^W/!_T,/!h,,/!fT,,/!W, ,/!W,C,/!W,D,/!W,E,/!W,H,/!_T,,/!n,&,/!MW/!XT,W/!Mc,/!Mc,/!W,/!Pu,*/!Pu,+/!Pu,,/!Pu,-/!Pu,./!Pu,//!Ja,%,-/!Pg,,-/!T,*,2/![T,(,2/![T,),2/![T,*,2/![T,+,2/![T,,,2/!T,o,6/!T,*,6/![T,V,8/!^W,2/!_T,,2/!h,,=/!fT,,>/!W, ,=/!W,C,@/!W,D,@/!W,E,@/!W,H,@/!_T,,=/!n,&,=/!MW,2/!XT,W,2/!Mc,,0/!Mc,,0?"$%&' 13;+ .L84.j.-.m.j. .  6 A=.q33 =>  6+3+-96383+ ,,>= ,6+3+ A =8.q378+ %%@%@@%@@@%@@ @ @@' %@@+ ppp`ppp0pppp`p``000`` `00``p``?+3'//!g,z/!g,{/!g,|/!g,}/!g,~/!g,/!g,/!g,/!g,/!g,/!g,/!g,/!Pu,*/!Pu,+/!Pu,,/!Pu,-/!Pu,./!Pu,//!Ja,%/!Pg,/!T,*/![T,(/![T,)/![T,*/![T,+/![T,,/!T,o,/!T,*,/![T,V,/!^W/!_T,/!h,,/!fT,, /!W, ,/!W,C,"/!W,D,"/!W,E,"/!W,H,"/!_T,,/!n,&,/!MW/!XT,W/!Mc,/!Mc,/!lc,\/!lc,\,-/!XT,W,./!lc,\/!XT,W,0/!xg,/!XT,W?!%'()*23 y A >88 B96388887' ' @`?'//!g,d/!g,e/!g,f/!xg,?+&6>??.L84..r A z.L84.j. -.m .j .  . 6 A=.q3+3+ =>  3+6+3+-96383+ ,,>= ,6+" S4' @%4' 7 S4' @%4' ? A >" B9638"87%+&@%%%@@%@@@%@@@ @ @' @' ' ' @+&`ppp0ppppp0pppp`p``000``` `00``p`?+p'//!g,</!g,=/!g,&/!g,'/!g,)/!g,+/!g,>/!g,?/!g,A/!g,B/!g,C/!g,D/!g,F/!g,G/!g,J/!g,K/!g,L/!g,/!u,4/!Ja,%/!u,`/!u,a/!u,b/!pg,,/!c,#,/!Mc,,/!t,,/!t,,/!t,,/!t,,/!t,,/!t,,/!b,, /!_T,S,!/!zW,,!/!Pu,*/!Pu,+/!Pu,,/!Pu,-/!Pu,./!Pu,//!Ja,%,&/!Pg,,&/!Pg,,+/!T,*,,/![T,(,,/![T,),,/![T,*,,/![T,+,,/![T,,,,/!T,o,0/!T,*,0/![T,V,2/!^W,,/!_T,,,/!h,,7/!fT,,8/!W, ,7/!W,C,:/!W,D,:/!W,E,:/!W,H,:/!_T,,7/!n,&,7/!MW,,/!XT,W,,/!Mc,,)/!Mc,,)/!g,/! u,l,E/!u,N,F/!c,#,G/!Mc,,H/!u,R,H/!t,G,J/!Ja,%,K/!N],K/ \,,J/ \,,N/! u,m,F/ \,,P/ \,,Q/ `\,,R/ N\,,S/ Y\,,R/!lc,\/!lc,\,V/!XT,W,W/!lc,\/!XT,W,Y/!g,/! u,l,[/!u,N,\/!c,#,]/!Mc,,^/!u,R,^/!t,G,`/!Ja,%,a/!N],a/ \,,`/ \,,d/! u,m,\/ \,,f/ \,,g/ `\,,h/ N\,,i/ Y\,,h/! g,c/! g,d/! g,e/! g,f/!xg,,n?"#*-569=?@,AB+++'')) R hpo>  R879638@0`?'//!G?Q  R963879638@0`?'//!,/!G?>  R879638@0`?'//!G?Q  R963879638@0`?'//!,/!G?>  R879638@0`?'//!G?Q  R963879638@0`?'//!,/!G?w S4@%4+ + ?? R963879638@0pp0`?'//!,/ \,?_  R96388879638@0`?'//#9\"69\"6?z  R9638!V!V R96389638 R9638 R!9\"6!V& R96388796389638963896389638@00000`?'//#9\"69\"6/!9\"69638,1/!9638,C/!9638 9638 /963896389638 ,"/#9\"69\"6?5+?.8.r A z.r633 >=  -Z 6 + ,  ,  A =88.O63+.q3+ , , ,>=-Z6+378+%%@@@%%@%%'@@%@%%@@@+p0ppp```000p`00p``p`000p```?+*'//!g,/!g,/!g,/!g,/!g,/!u,A/!u,/!u,`/!u,a/!u,b/!pg,/!c,#/!Mc,/!t,/!t,/!t,/!t,/!t,/!t,/!b,/!_T,S/!zW,/!Mc,/!Pt,/!et,,/!t,G,/!Ja,%,/!N],/!|h,z,/!_T,S,/!xg,/!Pt,/!Pt,/!Pt,/!Pt,/!Pt,/!t,G,"/!Ja,%,%/!N],%/!Qb, ,"/!XT,W,#/!N],#? ("")I+. L8 S4'@%4'..r A z.r633 >=  -Z 6 + ,  ,  A =8.O6+3+.q3+ , , ,>=-Z6+33+7+%'%%@@@%%@%%'@@%@%%@@@@+p0ppp```000p`00p``p`000p````?+3'//!g,H/!g,H/!g,H/ \,/ \,/ `\,/ N\,/ Y\,/!g,/!g,/!g,/!g,/!g,/!g,/!u,A/!u,/!u,`/!u,a/!u,b/!pg,/!c,#/!Mc,,/!t,,/!t,,/!t,,/!t,,/!t,,/!t,,/!b,,/!_T,S,/!zW,,/!Mc,/!Pt,/!et,,!/!t,G,"/!Ja,%,#/!N],#/!|h,z,"/!_T,S,&/!xg,/!Pt,/!Pt,/!Pt,/!Pt,/!Pt,/!t,G,+/!Ja,%,./!N],./!Qb, ,+/!XT,W,,/!N],,?'! (1++2 -I+. L8 S4'@%4'..r A z.r633 >=  -Z 6 + ,  ,  A =8.O6+3+.q3+ , , ,>=-Z6+33+3+7+%'%%@@@%%@%%'@@%@%%@@@@@+p0ppp```000p`00p``p`000p`````?+4'//!g,F/!g,H/!g,H/!g,H/ \,/ \,/ `\,/ N\,/ Y\,/!g,/!g,/!g,/!g,/!g,/!g,/!u,A/!u,/!u,`/!u,a/!u,b/!pg,/!c,#/!Mc,,/!t,,/!t,,/!t,,/!t,,/!t,,/!t,,/!b,,/!_T,S,/!zW,,/!Mc,/!Pt,/!et,,"/!t,G,#/!Ja,%,$/!N],$/!|h,z,#/!_T,S,'/!xg,/!Pt,/!Pt,/!Pt,/!Pt,/!Pt,/!t,G,,/!Ja,%,//!N],//!Qb, ,,/!XT,W,-/!N],-? (" )2,,3+! S4@%4 $ S4(&@4.j-. +?.  . &6 B 473. j ~3333 S4$4  3 &3+3+3+? S4'@%4' S4'9638@%4'9638????? R87 +!@(&%%&@@@@@@@@@@@@''96389638@+!0p0ppp`P``p````````p00ppppp0`?+%'//!1,E/!1,F/!g,x/!g,{/!g,|/!g,}/!g,~/ \,/ \,/!g,/!g,/!g,/!g,/!g,/!g,/!Y,B/!Y,A/!N,/!^W/!,&/!,'/!`W,!,/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,#,/!YW,",/ \,/ \,? !!!$%I  AL88 7&@P`?'//!Mc,? .m86.m83? =6 AL88>.q8. F 7 7V@@@&%9638@@p`p`pp`Ppp``?'//!Pc,G/!Pc,H/!fT,/!fT,/!Mc,/!XT,W? H?3?? AL8>. F3?7@@@p`0`pp`0`?'//!Pc,G/!Pc,H/!Pc,F/!Pc,G/!Pc,H/!fT,/!fT,/!Mc,/!XT,W? +??3? AL8>3?36>+- ,,' ,,( ,,. &6 3+. 6+ - 3+. 6+3+- U7 ,.q .m 6+ .m 3+!? ,, =6!+& AL8 >.q 3+'3+' ,%# ,%$ ,%,&=>-Z)6*+-3 ,+ B >>V>%-.3+2? AL8>3+5?3+66>+j ,6,i2d ,6,ie.7&69+E7&y Bh9<; $= S4 (&@4 =- =.j@ B /?A &>3+Y.76E+O7 $G S4 (&@4 G- G.jJ B /IK &H3+Y.76O+W7 S4?(&@4 Q.jR S4@A4 SS B /RT3+Y- U7.m86Y+].m83+^? ,\,][=6^+c AL88>.q83+d3+d ,b` ,ba ,b,c=>-Zf6g+j3+7.L/4.L/4p-j.rlk6m+.kl. o+?.  p. q&6r+v B 4o73+w. j ~o3+y3+z3+{3+| S4@4 jww3+~3+.Okl-Z6+.rk6+ B7.lk. +?.  . &6+ B 473+. j ~3+3+3+3+ S4@4 j3+?3+3+ S4@4 j7+@@@@&%%%%%@@@&%@@&%@@%@@@@&%&:@(&%%@@(&%%@(&A%@@@&%@@&%@@%%@%%&@@@@@@@@@@@@%%&@@@@@@@@@@@+pp`0p`0``00pp``p`pp`p``@`ppp`p`pp`Pp``000p``p0`0p`0``00p`p0pp`p`ppp`p`pp`@`p`p`pp`Pp``000p``000p`pppp`P``p````@``pp`p`P`pppp`P``p````@````?+'//!2,/!2,/!2,/!2,/!2,/!2,/!2,/!2,/!2,/!2,/!2,/!Pc,F/!Pc,G/!Pc,H/!Pc,F/!Pc,G/!Pc,H/!fT,/!fT,/!Mc,/!XT,W/!2,w/!2,x/!2,y/!2,z/!2,{/!2,|/!2,}/!2,~/!2,/!2,/!2,/!2,/!2,/!2,/!a,,/!XT,W/!Pc,F/!Pc,G/!Pc,H/!fT,,(/!fT,,(/!Mc,,(/!XT,W,(/ i\,n/!,j/!Pc,F/!Pc,G/!Pc,H/!Pc,F,1/!Pc,G,1/!Pc,H,1/!fT,,4/!fT,,4/!Mc,,4/!XT,W,4/! ],/!y,q,9/! 2,,9/! 2,,9/![2,,;/! ,o,=/!Y,;,>/!a,,=/!W,C,=/!W,D,=/!W,E,=/!W,H,=/ \,,=/ \,,E/! 2,/! 2,/![2,,G/! ,o,I/!Y,;,J/!a,,I/!W,C,I/!W,D,I/!W,E,I/!W,H,I/ \,,I/ \,,Q/! ],/! ],/![8,,S/![8,,S/![8,,S/!Y,9,V/!`W,,W/!N,,Y/!,,Z/!YW,",W/!Pc,F/!Pc,G/!Pc,H/!fT,,_/!fT,,_/!Mc,,_/!XT,W,_/!,/!Ja,%,d/!Ja,%,d/!ig, ,d/!ig,!,d/!ig,",d/!ig,#,d/!ig,$,d/!ig,%,d/!ig,&,d/!ig,(,d/!ig,*,d/!^W,h/!|h,z,i/!_T,S,q/![T,V,j/!Ng,0,j/!`W,,t/!N],u/ ~\,,v/ \,,w/ \,,x/ \,,x/ \,,x/ \,,x/ \,|,{/ \,},{/ \,~,{/!YW,",t/!vh,,k/!Qb, ,/!kn,#,/!_T,S,l/![T,V,n/!g,9,n/!`W,,/!N],/ ~\,,/ \,,/ \,,/ \,,/ \,,/ \,,/ \,|,/ \,},/ \,~,/!YW,",/!,C?$%)(*((+,((.74 9:=?@C== IKLOII X[WW `_a__bc__ efpris{{{xtklmmon. L8. L8. L8. L8 B7&@pppp`?'//!y2,?e! B!88-y--U7@@@HHX`?'//#,]/!y2,?. 78@`?'//!W,?. 78@`?'//!W,?. 78@`?'//!W,?. 78@`?'//!W,?638G.!J4I7?/#96389638,)? #self#e 638G.!J4I7?/#96389638,Y? #self#e 63896389638.!J49638-9638-7?/#96389638,}? #self#r638.!J49638-963867V96389638.!J49638-7?/#96389638,~? #self#r63896389638.!J963849638-9638--7?/#96389638,4? #self#http63896389638.!J963849638-9638--7?/#96389638,.? #self#http638: Writing fragmented message`!(ws.writeclosed)`: Writing non-control message0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl&+ I"      I96389638 I-!M9638.96386+; I9638 I# I A9638.9638O9638V-9638k6+; I49638 A9638963896386+; I9638.9638w96386!+%!9638 I-# I + V+-.!J49638 I .!y'9638 I A i I#> W3+2 W I  A!963896389638  > I#= ~&6#+; A!i.!@3 -!e465+9 A963896389638   3+: A 4963896389638   3+;9638V.!J49638-k<-9638k=6>+H 06@+D I$-963896383+E I$9638V$.963896389638E-9638UF-9638"-kH6I+-9638"-kK6L+ I > I I-P".OV6Q+U I"G3+ I96389638 I-!M9638.9638_`6a+ I9638 I# I A9638.9638O9638V-9638kf6g+ I49638 A9638963896386j+ I9638.9638w96386m+q!9638 I-o I+ V+y.!J49638 I.!ys9638 I A i I%> W3+~ W I  A!963896389638  > I%= ~r6%+ A!i.!@-!e6+ A963896389638 3+ A 963896389638 3+9638V.!l I. L I. L A!l I. L I.P"6>+! .!J49638.OV6 + I&-96383+ I&9638&.!J49638.9638 A9638.9638 I .X I =.OV6+3+3+.!l I. L I!. L A!l! I. L I.P"3+7?.!J49638-9638".!J49638.9638" A9638>.96387++?+D/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,/#59638 ,,/#96389638,/#96389638,/#96389638,/#96389638, /#96389638, /#96389638, /#96389638, /#96389638,/#5,~,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,,"/#5,s,"/#5,t,"/#5,u,"/#5,v,"/#5,x,"/#5,y,"/#5,,"/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?  !########$%&&&&'()***+,,-..//034456666678888888889:::::;<=============>???@@@@@ABDDDDDDD#self#wsxnextstatestitemstatenfirstmsgkwargslinefileidlogger_modulegroupstd_levellevelerrmsgkwargslinefileidlogger_modulegroupstd_levellevelerrx6384# -9638>.96389638.963896387?/#9638,? #self#xh6384$ß7-9638>.96389638.963896387?/#9638,? #self#xh6384Dk--9638>.96389638.963896387?/#9638,? #self#xh638pmptpLp;79638?/#9638,?#self##unused#638'@'pp'p'p(p0(p;79638?/#9638,?#self##unused#638 ;79638?/#9638,?#self##unused#638a.!J49638-96387?/#96389638,? #self#m638a.!J49638-96387?/#96389638,? #self#s638 +,  -e67V3 I -J I - I.!M -96386 I.37V I . .|  6+-963873+ I.!M .Q9638.6+3+7V I . .|  6 +%-96387"3+% I.!M -96386&+* I.3++7V.96387++,+,?/#96389638,;/#96389638,</#96389638,>/#96389638,?/#96389638,@/#96389638,A/#96389638,C/#96389638,F/#96389638,G/#96389638,H/#96389638,I/#96389638,K/#96389638,L/#96389638,M/#96389638,N/#96389638,O/#96389638,Q/#96389638,S? .#self##unused#vminord2dotmajord1ilen638 A!496389638.!J49638.96387??/#96389638,0/#96389638,1/#96389638,2? #self#fpos638 I.!J496389638.!J49638.96387?/#96389638,+/#96389638,,/#96389638,-?#self#findex638TH-^ A7?/#96389638, ?#self#httpbuf638-^.|6.i3 $- - A9638 &7 ?/#96389638, /#96389638, ?#self#httpbufn638^H-9638 A7?/#96389638,?#self#httpbuf638& large enough for response body size: (Unable to grow response stream IOBuffer +$!9638-..!l I. L I. L A!l I. L._6 A!y96389638- -U 3 $- A9638 &.!J496386+.!J4p-.X A!4p3+$.!J49638-.X A!49638.!J4p.!J49638.[ .! A!4p"7+$+$?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638, /#96389638,"/#96389638,#/#96389638,%?#self#httpbufnnbmaxp638a.!J49638-96387?/#96389638,? #self#m638 9638.!J49638.9638.!J49638 A!49638 A!49638+7??/#96389638,/#96389638,/#96389638, /#96389638,!? #self#f6389638.!J49638.9638 A!49638+7??/#96389638,%/#96389638,&/#96389638,'? #self#f638a.!J49638-96387?/#96389638,? #self#m6389638.!J49638.9638.!J49638 A!496387??/#96389638,/#96389638,/#96389638,? #self#f638 +% I I .!J49638 I-9638.|6 I.D .!J49638 A9638   I.X I .[  A9638 A!49638.| 6+% V+.!J49638 A9638 A9638 A!49638 W3+% W I !9638.w6+# A9638-U 3+#- ~7V+%+%?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? #self#cpnnblepn638v I._6-96386 A9638-U.X.[ A9638  I.X 37V?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#httppnnread638NH-.7?/#96389638,? #self#http638Y I-9638.Q6-!M7.!J49638.D I.-^.9638 7?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#httpnbytesntr638D-7?/#96389638,5? #self#f638;7V?/#96389638,@? #self#io638🗣 Write done: 1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl`iswritable(c)` +A-9638-9638k6 06 I-963896383 I9638V.963896389638 -9638U = A!49638   I 96389638 I   -!M9638.96386+? I 9638  I # I A9638    .9638O9638V-9638k6 +? I49638 A96389638 9638    6#+? I9638.9638w96386&+*!9638 I-( I+  V+1 I.!y9638 I A i I> W3+6 W I  A!9638 96389638    > I= ~+6+? A!i.!@7-!e869+= A96389638 9638   3+> A 896389638 9638   3+?9638V-96387?+A+A?+/#96389638, /#59638,/#96389638, /#96389638, /#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,/#96389638,? L#self#cmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638-9638-k67?-9638.!J49638-96387?/#96389638,t/#96389638,u/#96389638,w/#96389638,x? #self#http638✋ "Connection: close": -/opt/julia/packages/HTTP/sJD5V/src/Streams.jl keep-aliveupgradeclose Connection+N-96386-9638.!J49638-9638.!J49638 A96389638963863+.!J49638 A9638 963896386 3+.!J49638.!J49638 ._9638 6+.!J49638 A963896389638 I-k3+ I=6+N  I 9638 9638 I   -!M9638.9638 "#6$+J I 9638 I # I A9638   .9638 O9638 V-9638 k)6*+J I49638 A9638 96389638   6-+J I9638.9638 w9638 60+4!9638 I-2 I+ V+<.!J49638 I.!y96386 I A i I> W3+A W I  A!96389638 9638    > I= ~56+J A!i.!@B-!eC6D+H A9638 96389638   3+I A C9638 96389638   3+J9638 V.!J49638-K7L7?+N+N?+/#96389638,}/#96389638,~/#96389638,/#96389638,/#96389638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#96389638,? O#self#httpmsgkwargslinefileidlogger_modulegroupstd_levellevelerr638Underlying error: HTTP.Request:HTTP.RequestError:2.9638.9638!b.!J49638..9638!9638.!J4I.7 ?/#96389638,\/#96389638,]/#96389638,^/#96389638,_/#96389638,`? #self#ioe638 seconds&TimeoutError: Connection closed after |.!J49638 A!y96389638. 7?/#96389638,9? #self#ioe638`: HTTP.ConnectError for url = `.!J49638 A!y96389638. !9638.!J4I.7?/#96389638,,/#96389638,-? #self#ioe638 d!9638 I A.[- I A d-9638 I.9638- A!49638 -9638 I. w63.!N I. 7?/#9638,p/#9638,q/#9638,r/#9638,s/#9638,t/#9638,u/#9638,v/#9638,w?##self##unused#strhttpmbuffer638invalid HTTP version string:  I.96389638.OV6-.!y9638--U37?/#9638,2/#9638,3/#9638,4?#self##unused#vver6389638- . K I R.!J4c.c7?/#96389638? #self#c#6 6389-96387?/#,? #self#x638:-9638& 7?/#,? #self#x6389-96387?/#,? #self#x638B-96387?/#9638,? #self#x638C-9638&7?/#9638,? #self#x638B-96387?/#9638,? #self#x638P-9638.q7?/#q9638,(? #self#vavb(@ 638P-9638.q7?/#q9638,)? #self#vavb(@638..!J49638.!J49638._67>3.!J49638.!J49638.|6 7=3.!J49638.!J49638._ 67>37=?/#q9638,+/#q9638,,/#q9638,-/#q9638,.? #self#vavb638.!J49638.!J49638.!J49638.9638.9638.96387?/#96389638,n? #self#xh638.!J49638.!J49638.Q6.!J49638.!J49638.Q6.!J49638.!J49638.Q  7 7=7=?/#9638,m? #self#ab638H96387?/#96389638,? #self#x638 R496387?/#9638,?#self##unused#638 R496387?/#9638,?#self##unused#638H49638 7?/#9638,?#self##unused#638-963867V3 V-9638. FV W7 W I -96386 V ~73- ~7?/#P9638,/#P9638,/#P9638,/#P9638,/#P9638,?#self#wsste638<H.V7?/#P9638,? #self#ws638M+@.!J49638.!J49638.Q6+@.!J4.!J4.Q6+?.!J49638.!J49638.Q  6 +>.!J49638.!J49638.Q 6+=.!J49638.!J49638.Q6+<.!J49638.!J49638.Q6+;.!J49638.!J49638.Q6+:.!J49638.!J49638.Q6+9.!J49638.!J49638.Q!"6#+8.!J49638.!J49638.Q%&6'+7.!J49638 .!J49638 .Q)*6++6.!J49638 .!J49638 .Q-.6/+5.!J49638 .!J49638 .Q12737=7=7=7=7=7=7=7=7=7=7=7=+@+@?/#Q9638 ,q? #self#ab638N-9638.Q7?/#Q9638,%? #self#vavb(@ 638N-9638.Q7?/#Q9638,&? #self#vavb(@638G.96387?/#M9638,U? #self#mk638i-<.[..s.".7?/#M9638,@? #self#xi638t I R9638.!J49638.96387?/#^9638? #self#f#1638=.!J49638-9638-k6-9638.!J49638.Q67>.!J49638-9638 7 ?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? #self#http638`isreadable(c) || !(isopen(c))`+-96386 I3-9638 I-k-9638k6 06 I-963896383 I9638V.963896389638-9638U-9638.|6+7=.!J49638-96387++?/#96389638 ,/#59638 ,/#96389638 ,/#96389638 ,/#96389638 ,? #self#c638a.!J49638-96387?/#96389638,? #self#m638s.!J49638.!J49638-^.|7?/#96389638? #self#f638 I-9638.!J49638!9638!9638. F.96386-96386.!J963849638.  =.!J963849638. >77??/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,/#96389638 ,?#self#csock638P.!J496387?/#96389638,? #self#c638a.!J49638-96387?/#96389638,>? #self#http638P.!J496387?/#96389638,? #self#c638a.!J49638-96387?/#96389638,? #self#http638a.!J49638-96387?/#96389638,? #self#c638a.!J49638-96387?/#96389638,N? #self#l638a.!J49638-96387?/#96389638,7? #self#http638a.!J49638-96387?/#96389638,? #self#s63887=?/#96389638? #self#f638O-.96387?/#9638,?#self#httpn6383See: https://github.com/BioJulia/BufferedStreams.jl:Use: io = BufferedInputStream(http::HTTP.Stream) instead. <Reading one byte at a time from HTTP.Stream is inefficient. -/opt/julia/packages/HTTP/sJD5V/src/Streams.jl+?.!J496386+7   I 96389638 I   -!M9638.9638 6+4 I 49638 I # I A9638   .9638O 9638V-9638k6+4 I49638 A963896389638    6+4 I9638 .9638w96386+!9638 I- I+ V+& I As9638 9638 9638 I A i I> W3++ W I  A!963896389638    > I= ~ 6+4 A!i.!@,-!e-6.+2 A963896389638    3+3 A -963896389638    3+49638V= A!496385-9638.Q768+< A9638-U:.9638.!J49638.=7>+?+??+/#9638,/#9638,/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638,/#9638,/#9638,/#9638,/#9638,? W#self#http#unused#msgkwargslinefileidlogger_modulegroupstd_levellevelerr638NH A9638.7?/#9638,)? #self#http638m.9638-96387?/#9638,)/#9638,*?#self#httpbuf638S.!J49638.7?/#9638,? #self#mn638O.!J49638-7?/#9638,? #self#m638 I-9638 I.D!9638 I- $-  A9638 &7?/#9638,/#9638,/#9638,/#9638,?#self#cnbbytesnb638.!J49638-9638.Q6-9638.!J49638.7?/#9638,/#9638,/#9638,?#self#c#unused#638m+ I I-!M._6+.!J49638.!J49638.!M.[ I.-^ I.X  .9638.!J49638.!J49638.!M-96386+.!J49638.X A!496383+.!J49638.!J49638-^.|6+3+3+37++?/#9638,@/#9638,A/#9638,B/#9638,C/#9638,D/#9638,E/#9638,F/#9638,G/#9638,H/#9638,I? #self#fnresultnbd638+ I-!M.!J49638 I-!P. O?-!Z6 I. L. L-.9638  I.!P . O?-!Z63.!J49638-^.X A!496387++?/#9638,7/#9638,8/#9638,9/#9638,:/#9638,;/#9638,<?#self#fresultio638.!J49638-9638.!J49638-9638.X7?/#96389638,? #self#c638}-9638.!J49638-9638.D7?/#96389638,? #self#http638.!J49638.w96386.!J49638-9638.!J49638-9638.[7.!J49638-9638 7 ?/#96389638,? #self#m638c!9638-9638-7?/#96389638,>? #self#c638-96386-9638-96386-9638 V.!J49638--9638.| 6 -9638 W3 W ~7??/#9638,A/#9638,B/#9638,D/#9638,E/#9638,G/#9638,H/#9638,I/#9638,J/#9638,L/#9638,O?  #self#c638O.!J49638-7?/#9638,O? #self#l638+=.!J49638-9638.!J49638- I.!J49638-!c V+ I+.!J49638 I-!P . O?-!Z 6 + I. L. L-9638 I.!P . O?-!Z6+3 W3+ W I-!9638. O6+ A!6>+; I.!J49638-!c V+- I+.!J49638-e$6%++ I W3+/3++ W3+/ W I-!9638. O60+3 A!. O63+63+; A9638.s69638?.X9638?7-9638 83+.!J49638 -9638 ;7<+=+=?+/#9638 ,/#9638 ,/#9638 ,/#59638 ,/#59638 , /#59638 , /#59638 , /#59638 ,/#59638 ,/#59638 ,/#59638 , /#9638 ,/#9638 ,/#59638 ,/#59638 , /#59638 , /#59638 , /#59638 ,/#59638 , /#9638 ,/#9638 ,/#9638 ,?  #self#stempctemp63807V?/#9638? #self#f638PH.9638+G.7?/#9638,J? #self#ws638 ws.readclosed: Closing websocket0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl +u-963867?3     I96389638 I-!M9638.96386+9 I 9638 I # I A9638  .9638O 9638V-9638k6+9 I 49638 A963896389638    6+9 I 9638 .9638w 96386+#!9638 I -! I+K V++.!J49638 I.!y%9638 I A i I> W3+0 W I  A!963896389638      > I= ~$6+9 A!i.!@1-!e263+7 A963896389638     3+8 A 2963896389638     3+99638V> A!49638:. K.!J49638 I-<=.!J49638-9638A-9638B-!C.@D.9638?E V+O.!J496389638.!J49638 A9638>IJ.9638HK W3+Q W ~G.!J49638-kQ6R+Z9638- . KTU I RV.9638X.!J49638-kZ6[+f V+a-9638 W3+e W> A!49638b ~]3+Z.!J496386f+i3+k-!l9638-!Ui.!J49638-kk6l+u.!J49638-9638n6o+t.!J49638-q3+t3+u7?+u+u?+)/#9638 ,J/#9638 ,K/#5,~/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,/#5,s/#5,t/#5,u/#5,v/#5,x/#5,y/#5,/#9638 ,L/#9638 ,M/#9638 ,N/#9638 ,O/#9638 ,P/#9638 ,Q/#9638 ,V/#9638 ,W/#9638 ,\/#9638 ,]/#9638 ,^/#9638 ,b/#9638 ,d/#9638 ,g/#9638 ,i/#9638 ,j?  !!!!!!"""#$$$$%%%&''''(((((((()Z#self#wsbody#15datamsgkwargslinefileidlogger_modulegroupstd_levellevelerr 638Y.!J49638 A7?/#9638,? #self#cpn638 +".Q67-9638-k6.!J49638-96386 -9638.!J49638-k 6 .!J49638 I A3+.!J496389638. K i- F- A y A[9638.!J49638 A.!J49638.[9638 I AX I.!J49638.X A!49638 7+"+"?/#9638,V/#9638,W/#9638,Y/#9638,Z/#9638,\/#9638,]/#9638,_/#9638,c/#9638,d? #self#httppnnw638 I.9638.!J49638.[ I.X7?/#[9638,/#[9638,/#[9638,?#self#iomnwritten638.HTTP/.!J49638-y.!J49638-y A[963896387?/#[9638,? #self#iov638: bytes waiting -byte excess s W +6-96386-9638 I-96383 I I-9638 A9638.!J49638.[  .  .9638.!y9638.!J49638.!J49638 .vG6+ I.!J49638 3+.!J49638 I-.!J49638 -.!J49638 -9638.|6+$.!J49638 -9638 I A!y9638 !96383+% IG.|6&+* I A!y9638 96383++ IG-96386,+3!9638-9638-./ I .!y9638 03+4 I G A  9638 96389638%+475+6+6?/#b9638,/#b9638,?#self#iocnwaiting638)HTTP.Multipart(, filename="")contenttransferencoding="" contenttype="data=::.!y9638 d.!J49638 A!y96389638.!J49638 A!y96389638 I A!.!J49638.OV63.!J49638 A!y9638 9638.9638   .9638 9638 A!y9638 9638 . 7?/#b9638,/#b9638,/#b9638,?#self#iomitems638 -byte body ⋮ \1******;(*CRLF)^((?>(?>Proxy-)?Authorization|(?>Set-)?Cookie): ).+$""":) <= (++ AQ49638=6-9638. .w96386.!J49638.  9638-9638 A 9638 96387?- A9638.9638 I.9638 9638 .9638 9638 I.9638 .[.!J49638 I-9638 I-96386+.[3+-k6+ 3+&.!J49638-9638 .9638!-^.|"#6$+*.!J49638-9638& A!y9638'9638.(. 96387?++++?/#b9638,[/#b9638,\/#b9638,]/#b9638,^/#b9638,`/#b9638,b/#b9638,c/#b9638,j/#b9638,k/#b9638,l/#b9638,n/#b9638,o/#b9638,p/#b9638,q/#b9638,r/#b9638,t/#b9638,u? ,#self#iomvalidsummarysummaryheader_str638)Node(s.!J49638 A!y96389638. 7?/#b9638,? #self#iox638)payload=mask= extendedlen=, flags=Frame(.!J49638.!J49638.!J49638.!J49638 A 96389638963896389638963896389638 9638 7?/#b9638 ,k? #self#iox638)len=masked=opcode=, final= FrameFlags(.!J49638.!J49638.!J49638.!J49638 A 96389638963896389638963896389638 9638 7?/#b9638 ,:? #self#iox638"). HTTPVersion(".!J49638-y.!J49638-y A 9638963896387?/#b9638,#? #self#iov638)Leaf(s.!J49638 A!y96389638. 7?/#b9638,? #self#iox638o.!J49638.!J49638.96387?/#N9638, ?#self##unused#v638D-96387?/#N9638,x?#self##unused#s638+& I-9638.Q496386.9638.|7.Q496386.9638.| 7 .Q496386 .9638.|7.Q496386+.9638.|7.Q49638 6+.9638 .".-9638 7.Q49638 6+".9638 .|7 .Q496386"+&.96387$7?+&+&?/#J9638,/#J9638, /#J9638,!/#J9638,"/#J9638,#/#J9638,$/#J9638,%/#J9638,&/#J9638,'/#J9638,(/#J9638,)/#J9638,*/#J9638,+/#J9638,,/#J9638,-? #self#xnmux638+l     . 0496386 I. L496383.!J49638.!J49638.!J49638.!J49638 I.9638. 0496386+. L49638. w6+3+ R 4963849638- U I3+ I9638. 0496386!+-. L49638 A KT. w#$6%+(3++ A KT R 4963849638(#- U) I#3+. IV. 049638 6/+9. L49638 . w162+53+7 R 4963849638 1- U5 I13+: I. 049638 6;+E. L49638 . w=6>+A3+C R 4963849638 =- UA I=3+F I+. 049638 6G+Q. L49638 . wI6J+M3+O R 4963849638 I- UM II3+R I=. 049638 6S+W I. L49638 3+X IV. 049638 6Y+c. L49638 . w[6\+_3+a R 4963849638 [- U_ I[3+d I-!M96389638. K ie.!f I -!g. L49638 Ai .:FRXdj7k+l+l?/#96389638,<?v#unused#reqproxysocket_typesocket_type_tlsreadtimeoutconnect_timeoutlogerrorslogtagcloseimmediatelykw...638[ ++ . 0496386. L49638. w6 3 R 4963849638- U I 3 I  . 0496386+. L49638. w6+3+ R 4963849638- U I 3+ I = . 0496386+" I . L496383+# I V 9638. K i$.!% I-!&. L49638 A(#)7*++++?/#96389638?6#unused#streamreadtimeoutlogerrorslogtagkw...638 +,     . 0496386. L49638. w 6 3 R 4963849638 - U I  3 I > . 0496386+ I . L496383+ I V . 0496386+ I . L496383+ I .9638 . 0496386+# I . L496383+$ I -!M9638 9638. K i%.!& I -!'. L49638 A)$*7++,+,?/#9638 9638 ,?[#unused#methodurlheadersbodycopyheadersresponse_streamhttp_versionverbosekw...638v I-!. L49638 A7?/#96389638,5?#unused#req_or_streamkw...638c +?   . 0496386 I . L496383 I V . 0496386 I . L496383 I V . 0496386+. L49638. w6+3+ R 4963849638- U I 3+ I > . 0496386 +*. L49638. w"6#+&3+( R 4963849638"- U& I "3++ I = . 0496386,+6. L49638. w.6/+23+4 R 4963849638.- U2 I .3+7 I = 9638. K i8.!9 I -!:. L49638 A< +7=7>+?+??/#96389638 ?_#unused#reqiofunctiondecompressbasicauthdetect_content_typecanonicalize_headerskw...638 +2  . 0496386. L49638. w 6 3 R 4963849638 - U I  3 I > . 0496386+ I . L496383+ I V . 0496386+#. L49638. w6+3+! R 4963849638- U I 3+$ I = . 0496386%+) I . L496383+* I V 9638. K i+.!, I -!-. L49638 A/$*071+2+2?/#96389638?D#unused#streamstatus_exceptiontimedoutlogerrorslogtagkw...638 +G. 0496386. L49638. w63 R 4963849638- U I3 I> I . 0496386+. L49638. w6+3+ R 4963849638- U I3+ I I. 0496386+ I. L496383+%9638. K i . F9638@-!" I. #9638 I%. 0496386'++ I. L496383+, I9638 I ,. 049638 6.+8. L49638 . w061+43+6 R 4963849638 0- U4 I03+9 I= I 99638 . K i;.!< I -!=. L49638    A?@ABCDE7F+G+G?/#9638 9638 ,?R#unused#reqretryretriesretry_delaysretry_checkkw...retry_non_idempotent638+. 0496386 I. L496383 I>. 0496386 +. L49638. w 963863 R 49638496389638 - U I 3+ I96389638. K i.! I-!. L49638 A 7++?/#96389638?(#unused#reqcookiescookiejarkw...638a +?   . 0496386. L49638. w 6 3 R 4963849638 - U I  3 I > . 0496386+. L49638. w6+3+ R 4963849638- U I 3+ I  . 0496386 +$ I . L496383+% I V . 0496386&+0. L49638. w(6)+,3+. R 4963849638(- U, I (3+1 I > . 04963862+6 I . L496383+7 I V 9638. K i8.!9 I -!:. L49638 A<%17=7>+?+??/#96389638 ?]#unused#reqredirectredirect_limitredirect_methodforwardheadersresponse_streamkw...638+%. 0496386. L49638. w63 R 4963849638- U I3 I>. 0496386+. L49638. w6+3+ R 4963849638- U I3+ I>9638. K i.!-!-!e6 +#3+$ A! A96387$+%+%?/#96389638,{?2#unused#iorequire_ssl_verificationkeepalive638+. 0496386. L49638T96389638 A K. w 6 3T96389638 A K  R 4963849638- U I3+ IV9638. K i.! I-! A96387++?/#96389638,?##unused#serversslconfigkw...638 +W     . 0496386+. L49638T96389638 A K  . w  63+T96389638 A K R 4963849638 - U I  3+ I V . 0496386+$. L49638. w6+ 3+" R 4963849638- U I 3+% I = . 0496386&+0. L49638. w(>6)+,3+. R 4963849638>(- U, I (3+1 I 96389638 . 04963862+D. L49638T!9638 A K567. w4869+<3+BT!9638 A K<=> R 4963849638?4- U@ I 43+E I V . 049638 6F+P. L49638 . wH6I+L3+N R 4963849638 H- UL I H3+Q I = 9638 . K iR.!S I -!T A9638 %1EQ 7V+W+W?/#9638 9638,'?N#unused#addrhostportsslconfigreuseaddrbacklogserverlistenanykw...638k I-! A96387?/#96389638,J?#unused#hostportkw...638g I-! A96387?/#96389638,K?#unused#portkw...638a I-!.96387?/#96389638,L?#unused#kw...638[+. 0496386. L49638. w63 R 4963849638- U I3 I>9638. K i.!-!-!e6+3+ A! A96387++?/#96389638,?#unused#layerrequest638 . 0496386 I. L496383 I>9638. K i .! -! -!e 6 3 A! A96387?/#96389638,?!#unused#bytesallow_obs_fold638| ? I-!9638. F A }!P7?/#96389638,q?#unused#argskwargs...638g I-! A96387?/#96389638,"?#unused#ukw...638 I-!9638 A F A }!P7?/#96389638,F?#unused#fargskw...638 +F     . 0496386 I . L496383 I V . 0496386 I . L496383 I 9638 . 0496386+. L49638. w>6+3+ R 4963849638>- U I 3+ I - . 0496386!++. L49638. w#>6$+'3+) R 4963849638>#- U' I #3+, I  . 0496386-+9. L49638 A KT9638. w/061+43+7 A KT9638 R 49638496384/- U5 I /3+: I V . 0496386;+? I . L496383+@ I = 9638 . K iA.!B I -!C A9638  ,:@ 7E+F+F?/#9638 9638 ,_?c#unused#flisteneron_shutdowntcpisvalidmax_connectionsreadtimeoutaccess_logverbosekw...638y I-!9638. F A }!P7?/#96389638,?#unused#akw...638 +?    . 0496386. L49638 A KT9638. w  6 3 A KT9638 R 4963849638 - U I  3 I V . 0496386+. L49638. w6+3+ R 4963849638- U I 3+!.!J963849638 I .9638 . 0496386"+,. L49638. w$6%+(3+* R 4963849638$- U( I $3+- I > . 0496386.+8. L49638. w061+43+6 R 49638496380- U4 I 03+9 I  9638 . K i:.!; I -!< A9638 !-9 7>+?+??/#9638 9638 ,j?N#unused#chostpoolrequire_ssl_verificationkeepalivereadtimeoutkw...638`+. 0496386. L49638. w63 R 4963849638- U I3 I9638. K i.!-!-!e6+3+ A! A96387++?/#96389638, ?*#unused#bytesboundaryDelimiterstart638n +=    . 0496386. L49638. w 6 3 R 4963849638 - U I  3 I = . 0496386+ I . L496383+ I = . 0496386+ I . L496383+ I A! . 0496386 +*. L49638. w">6#+&3+( R 4963849638>"- U& I "3++ I - . 0496386,+6. L49638. w.>6/+23+4 R 4963849638>.- U2 I .3+7 I 9638 9638. K i8.!9 I -!: A9638+7 7<+=+=?/#9638 9638 ,a?[#unused#furlsuppress_close_errorverboseheadersmaxframesizemaxfragmentationkw...638jH-!M9638 A7?/#96389638,C?#s49fmethodurl638s I-! A96387?/#96389638,C?"#s49fmethodurlheaderskw...638g +%  . 0496386. L49638. w63 R 4963849638- U I 3.!J963849638 I .9638 . 0496386+. L4963896389638. w6+3+96389638 R 4963849638- U I 3+ I -!M9638 9638 . K i .!! I -!" A9638  7$+%+%?/#9638 9638 ,M??#unused#tcphostrequire_ssl_verificationsslconfigkw...638E +#  . 0496386. L49638. w63 R 4963849638- U I 3.!J963849638 I .9638 . 0496386+. L49638. w96386+3+ R 49638496389638- U I 3+ I 9638 9638. K i.! I -! A9638  7"+#+#?/#9638 9638 ,[??#unused#tcphostrequire_ssl_verificationsslconfigkw...638[+. 0496386. L49638. w63 R 4963849638- U I3 I>9638. K i.!-!-!e6+3+ A! A96387++?/#96389638,?#unused#layerrequest638b+. 0496386. L49638. w63 R 4963849638- U I3 I=9638. K i.! I-!9638 A F A }!P7++?/#96389638,? #unused#fargsstreamkw...638| ? I-!9638. F A }!P7?/#96389638,q?#unused#argskwargs...638hHV-!M9638 A7?/#96389638,`? #s49url638fH-!M9638 A7?/#96389638,`?#s49urllocal_path638  . 0496386 I . L496383 I  9638. K i .! I-! A9638 7?/#96389638,`?3#s49urllocal_pathheadersupdate_periodkw...638 I-!9638 A F A }!P7?/#96389638,?#unused#fargskw...638fH-!M9638 A7?/#96389638,\?#s49methodurl638o I-! A96387?/#96389638,\? #s49methodurlheaderskw...6381 +9   . 0496386 I . L496383 I V . 0496386+. L49638 A KT. w6+3+ A KT R 4963849638- U I 3+ I V . 0496386+&. L49638. w6+"3+$ R 4963849638- U" I 3+' I = . 0496386(+, I . L496383+- I V . 0496386.+2 I . L496383+3 I V 9638. K i4.!5 I -!6 A9638 '-3 78+9+9?/#96389638 ,?I#unused#streamiofunctiondecompresslogerrorslogtagtimedoutkw...638y I-!9638. F A }!P7?/#96389638,?#unused#akw...638+. 0496386. L49638 A KT9638. w63 A KT9638 R 4963849638 - U I3 IV9638. K i.! I-! A96387++?/#96389638,?#unused#creusepoolkw...638p I-!9638. F A }!P7?/#Q9638,?#unused#akw...638 +"  . 0496386. L49638. w63 R 4963849638- U I 3 I > . 0496386+. L49638. w6+3+ R 4963849638- U I 3+ I  9638. K i.! I -! A9638 7!+"+"?/#96389638,?3#unused#hostportkeepalivereadtimeoutkw...638o I-! A96387?/#96389638,7?#unused#hostportkw...638o I-! A96387?/#96389638,B?#unused#hostportkw...638 I-!9638 A F A }!P7?/#96389638,?#unused#fargskw...638y I-!9638. F A }!P7?/#96389638, ?#unused#akw...638P+. 0496386. L49638. w63 R 4963849638- U I3 I>9638. K i.!-!-!e6+3+.!.96387++?/#96389638,?#unused#request638P+. 0496386. L49638. w63 R 4963849638- U I3 I>9638. K i.!-!-!e6+3+.!.96387++?/#96389638,?#unused#request638h +=    . 0496386. L49638. w 6 3 R 4963849638 - U I  3 I = . 0496386+. L49638. w>6+3+ R 4963849638>- U I 3+ I - . 0496386 +*. L49638. w">6#+&3+( R 4963849638>"- U& I "3++ I 9638 . 0496386,+0 I . L496383+1 I = . 04963862+6 I . L496383+7 I > 9638. K i8.!9 I -!: A9638+17 7<+=+=?/#9638 9638 ,?[#unused#fhttpsuppress_close_errormaxframesizemaxfragmentationnaglequickackkw...638$+Z     . 0496386 +. L49638 A KT9638. w  63 A KT9638 R 4963849638 - U I 3+ IV. 0496386+ I. L496383+ IV. 0496386+(. L49638. w 6!+$3+& R 4963849638 - U$ I 3+) I=. 0496386*+. I. L496383+/ I-. 04963860+:. L49638. w263+63+8 R 49638496382- U6 I23+; I-!M9638. 0496386<+F. L49638. w>6?+B3+D R 4963849638>- UB I>3+H.!J9638 49638 I.F9638 . 049638 6I+S. L49638 . wK6L+O3+Q R 4963849638 K- UO IK3+T I>9638 . K iU.!V I-!W A9638)/;HT7Y+Z+Z?/#96389638,?|#unused#hostportpoolconnection_limitforcenewidle_timeoutconnect_timeoutrequire_ssl_verificationkeepalivekw...638w+. 0496386 I. L496383 Im. 0496386 I. L496383 IQ9638. K i.!-!-!e6+3+ A! A9638 7++?/#96389638,?#unused#yitrbyeq638y I-!9638. F A }!P7?/#96389638,)?#unused#akw...638b+. 0496386. L49638. w63 R 4963849638- U I3 I=9638. K i.! I-!9638 A F A }!P7++?/#96389638,? #unused#fargsstreamkw...638| ? I-!9638. F A }!P7?/#96389638,q?#unused#argskwargs...638`H AV96387?/#96389638,9?#s49methodurl638bH A96387?/#96389638,9?#s49methodurlh638r +*     . 0496386 I . L496383 I  . 0496386 I . L496383 I  . 0496386+ I . L496383+ I V . 0496386+#. L49638. w6+3+! R 4963849638- U I 3+$ I = 9638. K i%.!& I -!' A9638 $ 7)+*+*?/#96389638,9?>#s49methodurlhbheadersbodyqueryobservelayerskw...638fH AV9638V7?/#96389638,?#s49stackmethodurl638hH A9638V7?/#96389638,?#s49stackmethodurlh638`H AV7?/#96389638,?#s49stackmethodurlhb638+    . 0496386 I. L496383 I. 0496386 I. L496383 I. 0496386+ I. L496383+ I 9638. K i.! I -! A9638   7++?/#96389638,?8#s49stackmethodurlhbqheadersbodyquerykw...638 I-!9638 A F A }!P7?/#96389638,E?#unused#fargskw...638k I-! A96387?/#96389638,H?#unused#flistenerkw...638. 0496386 I. L496383 I9638. K i .! -! -!e 6 3 A! A96387?/#96389638,Y?!#unused#bytesboundarystart638 +2   . 0496386. L49638. w63 R 4963849638- U I 3 I = . 0496386+. L49638. w6+3+ R 4963849638- U I 3+ I = . 0496386+'. L49638. w6 +#3+% R 4963849638- U# I 3+( I = 9638. K i).!*-!+-!e,6-+03+1 A! A9638(71+2+2?/#96389638,`?7#unused#finalopcodeclientpayloadrsv1rsv2rsv3638 +2   . 0496386. L49638. w63 R 4963849638- U I 3 I = . 0496386+. L49638. w6+3+ R 4963849638- U I 3+ I = . 0496386+'. L49638. w6 +#3+% R 4963849638- U# I 3+( I = 9638. K i).!*-!+-!e,6-+03+1 A! A9638(71+2+2?/#96389638,1?3#unused#finalopcodemaskedlenrsv1rsv2rsv3638 + . 0496386 I . L496383 I .9638 . 0496386 I . L496383 I V 9638. K i.!-!-!e6+3+ A! A9638 7++?/#96389638,i?0#unused#statusheadersbodyversionrequest638YH A! A7?/#96389638,p?#s49status638+. 0496386 I. L496383 I9638. 0496386 I. L496383 IV9638. K i.!-!-!e6+3+ A! A9638 7++?/#96389638,p?$#s49statusheadersbodyrequest638W+. 0496386 I. L496383-96389638. K i- F-  I A  y9638. K i.!-!-!e6+3+ A! A9638 7++?/#96389638,h?#unused#dboundary638g I-! A96387?/#96389638,_?#unused#cookiekwargs...638a I-!.96387?/#96389638,e?#unused#kwargs...638SH AG7?/#96389638,g?#s49namevalue638o I-! A96387?/#96389638,g?#s49namevaluerawargs...638iH A! A96387?/#96389638,?#s49methodtarget638bH A96387?/#96389638,?#s49methodtargetheaders638 +4     . 0496386 I . L496383 I .9638 . 0496386 +. L49638. w963863+ R 49638496389638- U I 3+ I A9638 . 0496386+ I . L496383+ I V . 04y6+# I . L4y3+$ I V . 0496386%+) I . L496383+* I A9638 9638. K i+.!,-!--!e.6/+23+3 A! A9638  $*73+4+4?/#9638 9638 ,?K#s49methodtargetheadersbodyversionurlresponsebodyparentcontext638tH A9638 A9638 A7?/#96389638,/? #s49io638eH A9638 A7?/#96389638,/?#s49ioreq638 +2  . 0496386. L49638. w63 R 4963849638- U I 3 I > . 0496386+. L49638. w>6+3+ R 4963849638>- U I 3+ I - . 0496386+'. L49638. w>6 +#3+% R 4963849638>- U# I 3+( I 9638 9638. K i).!*-!+-!e,6-+03+1 A! A9638(71+2+2?/#96389638,/?9#s49ioreqrespclientmaxframesizemaxfragmentation638X+ I.!J49638.9638.!l I. L I. L A!l I. L I. L A!l I. L .OV6 .!J49638- 7.O6+.!J49638-7.!J49638 A!x49638-e-k6+.!J49638 A!x49638-7++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? #rstreamparamsroutehandlerreq638X+.9638.!l I. L I. L A!l I. L I. L A!l I. L.OV6 .!J49638- 7 .O6.!J49638-7.!J49638 A!x49638-e-k6+.!J49638 A!x49638-7++?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,? rreqparamsroutehandler638 +%.  I . w 63 I .!N  .  I . w 6 3 I .!N  .  I . w 63+ I .!N  .  I. w6+3+ I.!N.  I. w6+"3+# I.!N R#7$+%+%?/#96389638,?3#ctor-self#addrhostnamehostportsslserver638q A K9638 d d R7?/#96389638,?)#self#addrhostnamehostportsslserver638jV A i-! A96387?/#96389638,?#self#server638V96389638V A i-! A9638==7?/#96389638,'?#self#addrhostport638h A i-! A96387?/#96389638,J?#self#hostport638d A i-! A96387?/#96389638,K? #self#port638^ A i-!.96387?/#96389638,L?#self#638b +.  I . w 63 I .!N  .  I. w6 3 I.!N.  I. w63+ I.!N.  I. w6+3+ I.!N R7++?/#96389638,[?,#ctor-self#_404_405routesmiddleware638q A K9638 d d d R7?/#96389638,[?##self#_404_405routesmiddleware638\H A96389638V7?/#96389638,f?#self#638TH A9638V7?/#96389638,f? #self#_404638LH AV7?/#96389638,f?#self#_404_405638j A9638 A96387?/#96389638,f?#self#_404_405middleware638;+3.  I. w63 I.!N.  I. w6 3 I.!N.  I . w 63+ I .!N  .  I . w 6+3+ I .!N  .  I . w 6+"3+# I .!N  .  I . w $6&+)3+* I .!N$  .  I . w +6-+03+1 I .!N+  R#*172+3+3?/#96389638?p#ctor-self#messagestreamwritechunkedreadchunkedwarn_not_to_read_one_byte_at_a_timentoreadnwritten638w A K9638 d d R7?/#96389638?d#self#messagestreamwritechunkedreadchunkedwarn_not_to_read_one_byte_at_a_timentoreadnwritten638l A K9638 d d A==>+7?/#96389638,'? #self#rio638 +%.  I . w 63 I .!N  .  I . w 6 3 I .!N  .  I . w 63+ I .!N  .  I. w6+3+ I.!N.  I. w6+"3+# I.!N R#7$+%+%?/#96389638,q?H#ctor-self#listeneron_shutdownconnectionstaskconnections_lock638k. K9638 d R7?/#96389638,q?>#self#listeneron_shutdownconnectionstaskconnections_lock638 +%.  I . w 63 I .!N  .  I . w 6 3 I .!N  .  I . w 63+ I .!N  .  I. w6+3+ I.!N.  I. w6+"3+# I.!N R#7$+%+%?/#96389638,?H#ctor-self#filenamedatacontenttypecontenttransferencodingname638k. K9638 d R7?/#96389638,?>#self#filenamedatacontenttypecontenttransferencodingname638MH AGGG7?/#96389638,?#self#fdata638PH AGG7?/#96389638,?#self#fdatact638SH AG7?/#96389638,?#self#fdatactcte638 I.?V6 I-3 IV I. K9638 d--- A    7 ?/#96389638,/#96389638,?#self#fdatactctenamef638!+r.  I!. w!63 I!.!N!!.  I . w 6 3 I .!N  .  I. w63+ I.!N.  I. w6+3+ I.!N.  I. w6+"3+# I.!N.  I. w$6&+)3+* I.!N$.  I. w+6-+03+1 I.!N+.  I . w264+73+8 I.!N2.  I . w96;+>3+? I.!N9.  I . w@6B+E3+F I.!N@.  I . wG6I+L3+M I.!NG.  I . wN6P+S3+T I.!NN.  I. wU6W+Z3+[ I.!NU.  I. w\6^+a3+b I.!N\.  I. wc6e+h3+i I.!Nc.  I. wj6l+o3+p I.!Nj R#*18?FMT[bip7q+r+r?/#96389638,Q?#ctor-self#hostportidle_timeoutrequire_ssl_verificationkeepalivepeerippeerportlocalportioclientconnectionbuffertimestampreadablewritablewritebufferstate638. K9638 d R     7?/#96389638,Q?#self#hostportidle_timeoutrequire_ssl_verificationkeepalivepeerippeerportlocalportioclientconnectionbuffertimestampreadablewritablewritebufferstate638[H A>7?/#96389638,s?D#self#hostportidle_timeoutrequire_ssl_verificationkeepaliveio638. K9638 d A F-9638-9638 A9638 A9638 A9638 A F==V A }!P7 ?/#96389638,s?K#self#hostportidle_timeoutrequire_ssl_verificationkeepaliveioclient638T A9638>>7?/#96389638,{? #self#io638O.9638&7?/#96389638,? #self#major638P.96387?/#96389638,? #self#v638S R96387?/#96389638,?#ctor-self#majorminor6389638.  I. w63 I.!N.  I. w 6 3 I.!N  R7?/#96389638,?#ctor-self#majorminor638O.N96387?/#96389638,? #self#v638K R96387?/#96389638,? #ctor-self#638S R96387?/#96389638,%?#ctor-self#urlerror6389638.  I. w63 I.!N.  I. w 6 3 I.!N  R7?/#96389638,%?#ctor-self#urlerror638[ R96387?/#96389638,F?+#ctor-self#flagsextendedlenmaskpayload638a A9638===7?/#96389638,`?##self#finalopcodeclientpayload638m +9638.  I . w 63 I .!N  .  I. w 6 3 I.!N .  I. w6+3+ I.!N.  I. w6+3+ I.!N R7++?/#96389638,F?/#ctor-self#flagsextendedlenmaskpayload638[ R96387?/#96389638,H?*#ctor-self#statusmethodtargetresponse638m +9638.  I . w 63 I .!N  .  I. w 6 3 I.!N .  I. w6+3+ I.!N.  I. w6+3+ I.!N R7++?/#96389638,H?.#ctor-self#statusmethodtargetresponse638O R96387?/#96389638,?#ctor-self#message6389638.  I. w63 I.!N R7 ?/#96389638,?#ctor-self#message638K R96387?/#96389638,}? #ctor-self#638S R96387?/#96389638,U?#ctor-self#requesterror638F!j<.7?/#<9638,>? #self#x638+ I-!M9638 I.9638 A9638963896389638. K-963896389638. K  - 963896389638 . K- A K9638 9638 A A9638   7++?/#9638 9638 ,v/#9638 9638 ,w?#self#maxmax638c R96387?/#96389638,m?/#ctor-self#locktcpmbedtlsopensslothermax638 +-9638.  I . w 63 I .!N  .  I . w  6 3 I .!N   .  I . w 6+3+ I .!N  .  I . w 6+3+ I .!N  .  I . w 6 +#3+$ I .!N  .  I. w%6'+*3++ I.!N% R$+7,+-+-?/#96389638,m?5#ctor-self#locktcpmbedtlsopensslothermax638BH-V7?/#96389638,v?#self#638x.!J49638.!J49638.96387?/#96389638,!? #self#v638 +&9638.  I . w 63 I .!N  .  I . w  6 3 I .!N   .  I . w 6+3+ I .!N  .  I. w6+3+ I.!N.  I. w6 +#3+$ I.!N R$7%+&+&?/#96389638,b?5#ctor-self#versionstatusheadersbodyrequest638|9638. K i- F- A 9638+7?/#96389638,v? #self#body638_ A9638.!J496387?/#96389638,s?#self#638d A96389638V7?/#96389638,p?#self#statusheaders638OH A!.7?/#96389638,p?#self#status638s.9638V A96387?/#96389638,i?#self#statusheadersbody638_ R96387?/#96389638,b?0#ctor-self#versionstatusheadersbodyrequest638}9638. K i- F- A 96387?/#96389638,t?#self#sbody6389638. K i-9638- F- A 96387?/#96389638,u?#self#sbody638m +9638.  I . w 63 I .!N  .  I. w 6 3 I.!N .  I. w6+3+ I.!N.  I. w6+3+ I.!N R7++?/#96389638,V?,#ctor-self#maskpatskipwscontenttype638S R96387?/#96389638,?#ctor-self#namepattern6389638.  I. w63 I.!N.  I. w 6 3 I.!N  R7?/#96389638,?#ctor-self#namepattern638`*problem parsing path variable for route: `.!J496389638 I..OV6 A!y96389638-I.!J49638 I.!M .!J49638.!M .OV6 IV3 I-9638.9638 7?/#96389638,/#96389638,/#96389638,/#96389638,/#96389638,?#self#patternpatre638o  R9638  7?/#96389638,?K#ctor-self#methodtargetversionheadersbodyresponseurlparentcontext638+B9638.  I. w63 I.!N.  I. w 6 3 I.!N .  I. w6+3+ I.!N.  I. w6+3+ I.!N.  I. w6 +#3+$ I.!N.  I. w%6'+*3++ I.!N%.  I . w ,6.+13+2 I .!N,  .  I  . w 365+83+9 I .!N3  .  I  . w :6<+?3+@ I .!N:  R$+29@7A+B+B?/#96389638,?T#ctor-self#methodtargetversionheadersbodyresponseurlparentcontext638K.9638GG7?/#96389638,?#self#638aH A! A96387?/#96389638,?#self#methodtarget638ZH A96387?/#96389638,?#self#methodtargetheaders638.9638 A9638VV A9638 A96387?/#96389638,?"#self#methodtargetheadersbody638w  R9638    7?/#96389638,?v#ctor-self#idiorequestresponsemaxframesizemaxfragmentationclientreadbufferwritebufferreadclosedwriteclosed638lH A9638 A9638 A7?/#96389638,/? #self#io638]H A9638 A7?/#96389638,/?#self#ioreq638u-9638 A9638>7?/#96389638,/?#self#ioreqresp638e+P9638.  I. w63 I.!N.  I. w 6 3 I.!N .  I. w6+3+ I.!N.  I. w6+3+ I.!N.  I. w6 +#3+$ I.!N.  I. w%6'+*3++ I.!N%.  I. w,6.+13+2 I.!N,.  I . w365+83+9 I.!N3.  I . w:6<+?3+@ I.!N:.  I . wA6C+F3+G I.!NA.  I  . w H6J+M3+N I .!NH  R$+29@GN7O+P+P?/#96389638,?#ctor-self#idiorequestresponsemaxframesizemaxfragmentationclientreadbufferwritebufferreadclosedwriteclosed638S R96387?/#96389638,?#ctor-self#hostport638O R96387?/#96389638,6?#ctor-self#readtimeout6389638.  I. w63 I.!N R7 ?/#96389638,6?#ctor-self#readtimeout638 R9638     7?/#96389638,H?#ctor-self#namevaluepathdomainexpiresrawexpirescreationlastaccessmaxagesecurehttponlypersistenthostonlysamesiterawunparsed638!+s9638.  I!. w!63 I!.!N!!.  I . w  6 3 I .!N   .  I. w6+3+ I.!N.  I. w6+3+ I.!N.  I. w6 +#3+$ I.!N.  I. w%6'+*3++ I.!N%.  I. w,6.+13+2 I.!N,.  I . w365+83+9 I.!N3.  I . w:6<+?3+@ I.!N:.  I . wA6C+F3+G I.!NA.  I . wH6J+M3+N I.!NH.  I . wO6Q+T3+U I.!NO.  I. wV6X+[3+\ I.!NV.  I. w]6_+b3+c I.!N].  I. wd6f+i3+j I.!Nd.  I. wk6m+p3+q I.!Nk R$+29@GNU\cjq7r+s+s?/#96389638,H?#ctor-self#namevaluepathdomainexpiresrawexpirescreationlastaccessmaxagesecurehttponlypersistenthostonlysamesiterawunparsed638d A i-! A96387?/#96389638,_?#self#cookie638^ A i-!.96387?/#96389638,e?#self#638KH AG7?/#96389638,g?#self#namevalue638l A i-! A96387?/#96389638,g?#self#namevalueraw638a A9638===7?/#96389638,1?#self#finalopcodemaskedlen638\.!J4j9638.7?/#96389638? #self#x638K R96387?/#96389638,? #ctor-self#638 I A9638.[-9638-7?/#9638,/#9638,/#9638, ? #self#mio638S R96387?/#96389638,?#ctor-self#statusmessage6389638.  I. w63 I.!N.  I. w 6 3 I.!N  R7?/#96389638,?#ctor-self#statusmessage638Y R96387?/#96389638?%#ctor-self#dataindexmarkboundary638k +9638.  I . w 63 I .!N  .  I. w 6 3 I.!N .  I. w6+3+ I.!N.  I. w6+3+ I.!N R7++?/#96389638?)#ctor-self#dataindexmarkboundary638:7?/#96389638? #self#f638-96389638. K i- F- A y A96387?/#96389638,h? #self#d6389638.  I. w63 I.!N R7 ?/#96389638?#ctor-self#re638c R96387?/#96389638,?B#ctor-self#segmentexactconditionalwildcarddoublestarmethods638 +-9638.  I . w 63 I .!N  .  I . w  6 3 I .!N   .  I . w 6+3+ I .!N  .  I . w 6+3+ I .!N  .  I . w 6 +#3+$ I .!N  .  I. w%6'+*3++ I.!N% R$+7,+-+-?/#96389638,?H#ctor-self#segmentexactconditionalwildcarddoublestarmethods638-!M9638-!M9638VV-!M9638 A96387?/#96389638,? #self#x638*T-963896387?/#96389638,?#self#638X!j9638.7?/#96389638,?? #self#x` .!j9638879638@p`?'//#96389638,??6389638.  I. w63 I.!N.  I. w 6 3 I.!N  R7?/#96389638?#ctor-self#lockentries638S R96387?/#96389638,H?#ctor-self#sigcontenttypeb  R96388879638@0`?'//#96389638,H?b  R96388879638@0`?'//#96389638,H?6389638.  I. w63 I.!N.  I. w 6 3 I.!N  R7?/#96389638,H?#ctor-self#sigcontenttype638[ R96387?/#96389638,?*#ctor-self#methodvariablespathhandler638m +9638.  I . w 63 I .!N  .  I. w 6 3 I.!N .  I. w6+3+ I.!N.  I. w6+3+ I.!N R7++?/#96389638,?.#ctor-self#methodvariablespathhandler638S R96387?/#96389638,.?#ctor-self#codebytes6389638.  I. w63 I.!N.  I. w 6 3 I.!N  R7?/#96389638,.?#ctor-self#codebytes638EH.G7?/#96389638,2? #self#code638-.96389638 -.96387?/#96389638,2?#self#codebytesRegexAndMatchDatare match_dataParsersStringsIOExtras__init__ isreadable iswritable-+==FunctionVararg #readuntil readuntil./opt/julia/packages/HTTP/sJD5V/src/IOExtras.jl-/opt/julia/packages/HTTP/sJD5V/src/Streams.jlntoreadnobytesstreamupdate_ntoreadEOFError Connections Exceptions|rethrowInterruptExceptionisatake!IOBuffer#current_exceptions_to_stringcurrent_exceptions_to_string0/opt/julia/packages/HTTP/sJD5V/src/Exceptions.jlcurrent_exceptions display_errorVERSION>=@v_str@staticprintlnInt16IntprintIOBaseExceptionUnwrappingString Exception ##meta#58 StatusErrortypesigmodule linenumberbindingpathfields RequestError@try TimeoutError ConnectErrorTupleUnionerrorisemptypop!Anyesc#1#2#1noneeescape#@tryblock||trycall&&@evalHTTP HTTPErrorrequeststatusmethodtargetresponse readtimeouturl#includeinclude#evaleval Conditionsnameofthrow<#@ensure@ensure0/opt/julia/packages/HTTP/sJD5V/src/Conditions.jl DEBUG_LEVEL isconditionargs_funcname_exprpostcondition_erroriftuple!firstlength #isconditionhead...operator_precedencejl_symbol_nameccalljl_operator_precedenceAssertionErrorstringshowsprint!=#postcondition_error@require #@requireprecondition_error ArgumentErrornothing===#precondition_error @noinlineExprSymbol#_funcname_expr#self# #tcpstatus tcpstatus1/opt/julia/packages/HTTP/sJD5V/src/Connections.jl has_tcpsocketuv_status_string tcpsocket Connectionhostport idle_timeoutrequire_ssl_verification keepalivepeerippeerport localportioclientconnectionbuffer timestampreadablewritable writebufferstateIO_tlpadround#23#25#23conn#22#24#22kw sslconnectioncIOType##sslupgrade#21#sslupgrade#21try_with_timeoutgetpool connectionkeyreleaseacquireforcenew #sslupgrade sslupgradeNetworkOptions verify_hostTnamesNVPoollocktcpmbedtlsopensslothermax##sslconnection#20#sslconnection#20 SSLContext nosslconfigglobal_sslconfigsetup! associate! hostname! handshake!#sslconnection nosslcontext#sslconnection#19##sslconnection#19 SSLStreamglobal_sslcontextconnect##getconnection#18#getconnection#18DebugHTTP_Connections_272a41d0 invokelatestfixup_stdlib_path logging_error getconnection TCPSocket#getconnection#getconnection#17#getconnection#16##getconnection#17HTTP_Connections_272a41cf#global_sslcontextENVTLSClientMethod ca_chain! isdefinedhaskey#global_sslconfig SSLConfigdefault_sslconfignoverify_sslconfig crt_parseErrorExceptionparse##getconnection#16HTTP_Connections_6fa3db10getalladdrinfo keepalive!#checkconnectedcheckconnectedStatusConnectingConnectTimeoutCuintCint #keepalive! iolock_begin check_openhandleuv_tcp_keepaliveuv_error iolock_end##releaseconnection#15#releaseconnection#15time#releaseconnectionreleaseconnection#11#14#11connection_isvalid#9#12#9connect_timeout#10#13#10##newconnection#8#newconnection#8connection_limit_warningisvalid#newconnection newconnectionDEFAULT_CONNECT_TIMEOUT#connection_limit_warningWarnHTTP_Connections_1a89f053@warn<=#connection_isvalidisopeninactivesecondsforeachvaluesdrain! #closeallcloseallTCP_POOL MBEDTLS_POOL OPENSSL_POOL OTHER_POOLunlocklock.jl#6#7#6CPoolpoolget!#4#5#4default_connection_limit#getpoolLockable somethingNothingIdDict ReentrantLockConcurrentUtilities readavailable#purgepurgeeofptrbytesavailable closeread closewrite errormonitor ##sync#48#2#3#2monitor_idle_connection @isdefinedclose#monitor_idle_connectionHTTP_Connections_67772f52IOErrorflush@debugv#read_to_bufferread_to_buffer ensureroomdata unsafe_readreadTypepointerminGC∉ unsafe_writeUIntUInt8Ptr>#shouldtimeout shouldtimeout#inactiveseconds #getrawstream getrawstreamStreammessage writechunked readchunked#warn_not_to_read_one_byte_at_a_timenwrittenSMMessageMessages StatusCodesfill5/opt/julia/packages/HTTP/sJD5V/src/status_messages.jlCONTINUESWITCHING_PROTOCOLS PROCESSING EARLY_HINTSOKCREATEDACCEPTEDNON_AUTHORITATIVE_INFORMATION NO_CONTENT RESET_CONTENTPARTIAL_CONTENT MULTI_STATUSALREADY_REPORTEDIM_USEDMULTIPLE_CHOICESMOVED_PERMANENTLYMOVED_TEMPORARILY SEE_OTHER NOT_MODIFIED USE_PROXYTEMPORARY_REDIRECTPERMANENT_REDIRECT BAD_REQUEST UNAUTHORIZEDPAYMENT_REQUIRED FORBIDDEN NOT_FOUNDMETHOD_NOT_ALLOWEDNOT_ACCEPTABLEPROXY_AUTHENTICATION_REQUIREDREQUEST_TIME_OUTCONFLICTGONELENGTH_REQUIREDPRECONDITION_FAILEDREQUEST_ENTITY_TOO_LARGEREQUEST_URI_TOO_LARGEUNSUPPORTED_MEDIA_TYPEREQUESTED_RANGE_NOT_SATISFIABLEEXPECTATION_FAILED IM_A_TEAPOTMISDIRECTED_REQUESTUNPROCESSABLE_ENTITYLOCKEDFAILED_DEPENDENCYUNORDERED_COLLECTIONUPGRADE_REQUIREDPRECONDITION_REQUIREDTOO_MANY_REQUESTSREQUEST_HEADER_FIELDS_TOO_LARGE LOGIN_TIMEOUTNGINX_ERROR_NO_RESPONSEUNAVAILABLE_FOR_LEGAL_REASONS!NGINX_ERROR_SSL_CERTIFICATE_ERROR$NGINX_ERROR_SSL_CERTIFICATE_REQUIREDNGINX_ERROR_HTTP_TO_HTTPS<NGINX_ERROR_OR_ANTIVIRUS_INTERCEPTED_REQUEST_OR_ARCGIS_ERRORINTERNAL_SERVER_ERRORNOT_IMPLEMENTED BAD_GATEWAYSERVICE_UNAVAILABLEGATEWAY_TIME_OUTHTTP_VERSION_NOT_SUPPORTEDVARIANT_ALSO_NEGOTIATESINSUFFICIENT_STORAGE LOOP_DETECTEDBANDWIDTH_LIMIT_EXCEEDED NOT_EXTENDEDNETWORK_AUTHENTICATION_REQUIREDCLOUDFLARE_SERVER_ERROR_UNKNOWN*CLOUDFLARE_SERVER_ERROR_CONNECTION_REFUSED*CLOUDFLARE_SERVER_ERROR_CONNECTION_TIMEOUT1CLOUDFLARE_SERVER_ERROR_ORIGIN_SERVER_UNREACHABLE!CLOUDFLARE_SERVER_ERROR_A_TIMEOUT)CLOUDFLARE_SERVER_ERROR_CONNECTION_FAILED0CLOUDFLARE_SERVER_ERROR_INVALID_SSL_CERITIFICATE%CLOUDFLARE_SERVER_ERROR_RAILGUN_ERROR SITE_FROZENjl_alloc_array_1d statustextSTATUS_MESSAGES #statustext1/opt/julia/packages/HTTP/sJD5V/src/StatusCodes.jlFormsSniffFloat64zero#isjsonisjson+/opt/julia/packages/HTTP/sJD5V/src/sniff.jlignorewhitespaceOPEN_CURLY_BRACE DOUBLE_QUOTE restofstringCOLONCLOSE_CURLY_BRACECOMMAOPEN_SQUARE_BRACEnextbyteCLOSE_SQUARE_BRACEZERONINEMINUSREF jl_strtod_cLITTLE_NLITTLE_ULITTLE_LLITTLE_TLITTLE_RLITTLE_ELITTLE_FLITTLE_ALITTLE_SMAXSNIFFLENGTHundefPERIOD#@expect@expectbreturni=bytesmaxlenESCAPE #restofstring #nextbyte#ignorewhitespace WHITESPACEDISPLAYABLE_TYPESJSONSigTextSig%<<UInt32#bigendbigendmp4mp4ftype #byteequal byteequal @inboundsMP4SigHTMLSightml& enumerateBoolMaskedmaskpatskipws contenttype eachindex#ismatchismatchsigExact #contenttypeSNIFF_SIGNATURESinresetmarkismarkedsniff#sniff codeunitsSetDictall: #iscompressed iscompressedZIPGZIPVector CodeUnits=> #content_type content_type//opt/julia/packages/HTTP/sJD5V/src/multipart.jlboundaryFormindexjoin pushfirst!AbstractStringbasename#writemultipartheaderwritemultipartheadernamefilenamecontenttransferencoding MultipartUInt128randpush! seekstartwrite*Pair<:eltype!==matchRegex##Form#3#Form#3@raw_strIntegerappend!unmarksumpositionfilesizeIOStreamPairs deleteat!#9#10+/opt/julia/packages/HTTP/sJD5V/src/Pairs.jleqk#rmkvrmkv findfirst#7#8#7#getkvgetkv#setkvsetkv setbyfirst#5#6#5#defaultbyfirstdefaultbyfirst#3#4#3 #getbyfirst getbyfirst #setbyfirst isnothing./opt/julia/packages/HTTP/sJD5V/src/Messages.jldepwarnreplacetypeof@s_str@r_str≠Int32sizeof #isvalidstr isvalidstr u8_isvalid#compactstartlinecompactstartlinewritestartlinestripURIsviewnbytes #bodysummary bodysummaryisbytes BODY_SHOW_MAX escapeuriRef #set_show_max set_show_maxfind_end_of_trailerparse_chunk_sizefind_end_of_chunk_size#readchunksize readchunksize SubStringparse_header_fields!parse_header_field#parse_header_fields! emptyheader appendheaderparse_request_line!parse_status_line!#parse_start_line!parse_start_line!Responseversionheadersbody HTTPVersionmajorminorRequestparentcontextfind_end_of_header #readheaders readheaders #writeheaders writeheaders#writestartline transcodeGzipDecompressor#decodedecodeiso8859_1_to_utf8#payloadpayload hasheaderheadersplit lowercase #removeheader removeheaderfield_name_isequal #appendheader#defaultheader!defaultheader! setheader #setheadersecondHeader#headercontainsheadercontainsany #hasheadermapfilter#7#9#6#8#headerascii_lc_isequal#field_name_isequal #bodylength bodylength ischunkedunknown_length#headerscompleteheaderscompleteendswith #ischunked NamedTuple AbstractDict#retryablebody retryablebody supportsmarkhasfield parentmodule #supportsmarkmethods #retryable retryable allow_retriesretrylimitreachednothing_written isidempotentretry_non_idempotent#s53#retrylimitreached#nothing_writtennothingwritten#allow_retries#retry_non_idempotent #isidempotentissafe#allow_redirectsallow_redirectsget#redirectlimitreachedredirectlimitreached #isredirect isredirect#iserroriserror#issafe#url#target#method #mkheaders mkheadersHeaders #resourceresourcequeryfragment ##Request#3 #Request#3URIContext#body#headersgetfield#statusdelete!empty!#reset!reset! response_bodyAbstractVector ##Response#2 #Response#2 ##Response#1 #Response#1nobody@assert#sprintcompact sprintcompactcompacttypemaxuri##Connection#1 #Connection#1 PipeBuffersafe_getpeernameConnectionKeyType#connectionkey applicable#has_tcpsocketF startread startwriteUInt16IPAddr#set_default_connection_limit!set_default_connection_limit!SocketsMbedTLSOpenSSLThreads #__init__nthreadscglobaljl_n_threads_per_poolxTLS_client_methodlibssl OpenSSLError SSLMethodMozillaCACerts_jll getglobalcacertSpinLock keyedvalues deprecated.jlthreadpoolsizethreadingconstructs.jl_nthreads_in_pool,/opt/julia/packages/OpenSSL/hXs2T/src/ssl.jl:/opt/julia/packages/ConcurrentUtilities/J6iMP/src/pools.jlGenericConditionIntrusiveLinkedListlinked_list.jl locks-mt.jlhash current_task#taskidtaskidbasepadnolimitStreams #incomplete incomplete #isaborted isabortedHTTP_Streams_92832591HTTP_Streams_e6006d83 readbytes! #readall!readall!resize!#http_unsafe_readhttp_unsafe_read#update_ntoread#ntoread@inline#handle_continuehandle_continueHTTP_Streams_ab1fd8e2HTTP_Streams_ab1fd8e1 #closebody closebody#messagetowritemessagetowrite #setstatus setstatus#s50IPv4#safe_getpeername getpeername #localport getsockname #tcpsocket0/opt/julia/packages/HTTP/sJD5V/src/WebSockets.jl WebSocketsServers#check_readtimeoutcheck_readtimeout-/opt/julia/packages/HTTP/sJD5V/src/Servers.jlHTTP_Servers_d4dbcdedcloseconnectionsleep ParseError#18#19#18wait_for_timeout#handle_connectionhandle_connectionTaskput!scheduleclosedorclosingHTTP_Servers_82e2e7bbACTIVEcodeHEADER_SIZE_EXCEEDS_LIMITHTTP_Servers_4bc042cbCLOSINGHTTP_Servers_1953627dHTTP_Servers_9c5ca8daHTTP_Servers_4a19a67fIDLELoggingErrorHTTP_Servers_406cefd0InfoaccessHTTP_Servers_c57ed004HTTP_Servers_fec9f87a@info@logmsgvnotify#16#17#16flistener access_log conns_lockconnssem #listenloop listenloop SemaphoreHTTP_Servers_913eff65hostnamehostportthreadidacceptHTTP_Servers_3ddd1b33HTTP_Servers_9a62c42fUV_ECONNABORTEDHTTP_Servers_4e14df8eHTTP_Servers_1f1dfaab@errorv@async@warnv@infov LoggingExtras#12#15#12 tcpisvalidmax_connectionsready_to_acceptverbose withlevel verbosity ##listen!#9 #listen!#9Eventsticky_spawn_set_thrpool interactivewaitServerListeneraddrsslserverI#listen!listen! #listen!#7TRUE#@_spawn_interactive@_spawn_interactive macrocall.@spawn hasmethodModuleLineNumberNode ##listen#8 #listen#8#listenlisten #listen#6 ##listen!#7 ##listen#6@error #shutdownshutdownHTTP_Servers_31ab91f9#closeconnectionCLOSED#requestclose! requestclose!#closedorclosingConnectionState@doc@enum #forceclose forceclose on_shutdownconnections_lock connectionstaskL#port#getsslcontext getsslcontext MbedException#accept ##Listener#5 #Listener#5 localhost ##Listener#4 #Listener#4 ##Listener#3 #Listener#3getinetCvoidSys ##Listener#2 #Listener#2 listenanysupportsreuseaddrHTTP_Servers_adfa2d31KERNEL TCPServerjl_tcp_reuseportHTTP_Servers_297f0f98bindbacklog reuseaddrdelay sslconfig@label@goto#supportsreuseaddrjl_has_so_reuseport ##Listener#1 #Listener#1#getinetInetAddr#TRUE @logfmt_str #@logfmt_str0/opt/julia/packages/HTTP/sJD5V/src/access_log.jl logfmt_parserSOCKET_TYPE_TLSaccess_threaded#access_threaded*/opt/julia/packages/HTTP/sJD5V/src/HTTP.jl_length_assert isassigned#receivereceiveHTTP_WebSockets_f252630eid readclosedFrame readbuffer readframeHTTP_WebSockets_0c9717f7checkreadframe!flagsopcode iscontrolHTTP_WebSockets_0c9717f8_appendHTTP_WebSockets_472e6f4e utf8checkHTTP_WebSockets_636de61e WebSocket maxframesizemaxfragmentationclient writeclosed#_append#checkreadframe!rsv1rsv2rsv3CloseFrameBodyWebSocketErrorfinalCLOSEPINGlencontrol_len_checkpongPONGTEXTMask FrameFlags extendedlen #utf8check#control_len_checkTimerprepend! reinterpret#15#16#15ws#pongHTTP_WebSockets_d88304a5 writeframe#pingpingHTTP_WebSockets_e28ac513iteratecopyto!isbinary#opcodeBINARY#istextistext #isbinary ##upgrade#14 #upgrade#14HTTP_WebSockets_112259ba isupgradehandshakeerror hashedkey StatusInit StatusUninitnaglequickackHTTP_WebSockets_a0bbcb47isokHTTP_WebSockets_bc4a5e77isclosed#upgradeupgradeDEFAULT_MAX_FRAG#12#13 ##listen!#11 #listen!#11catch_backtracekeyHTTP_WebSockets_46931481suppress_close_errorHTTP_WebSockets_82886f84(e, catch_backtrace())##open#5#open#5Random RandomDevice base64encodeopen#open#open#44 #hashedkeydigestMD_SHA1#handshakeerror##is_upgrade#4 #is_upgrade#4Typeof is_upgrademt #is_upgrade @deprecate #isupgrade #iscloseduuid4 ##WebSocket#3 #WebSocket#3UUID#isok#validclosecheckvalidclosecheckSTATUS_CODE_DESCRIPTIONhton #writeframeuint16 EMPTY_MASKsendOpCodecopy unsafe_stringread!ntoh #readframeiocheckmaskedmask! CONTINUATION#iocheck ##Frame#2#Frame#2wslength⊻#mask! #wslengthUInt64#mask##FrameFlags#1 #FrameFlags#1WS_FINALWS_RSV1WS_RSV2WS_RSV3WS_MASK>> #iscontrolWS_LEN WS_OPCODE#uint16bio #closereadHTTP_Streams_49c821e6HTTP_Connections_c9ffe48adefault #startreadHTTP_Connections_17569272 #startwriteHTTP_Connections_bf34fe19_doc#nbytes#isbytes#bytes#ascii_lc_isequal-/opt/julia/packages/HTTP/sJD5V/src/Strings.jlascii_lc #ascii_lc#iso8859_1_to_utf8#lowerlower#isupperisupper#islowerislower #tocameldash tocameldash #escapehtml escapehtmlnextindisdigit firstindex ncodeunitsreprtryparseislessconvert VersionNumber-/opt/julia/packages/HTTP/sJD5V/src/Parsers.jl maxthreadidstatus_line_regexrequest_line_regexheader_field_regexobs_fold_header_field_regexempty_header_field_regex jl_n_threadsjl_array_del_endjl_array_grow_end_throw_argerrorInt8unhexInt64#parse_chunk_size skip_crlfchunk_size_limitCHUNK_SIZE_EXCEEDS_LIMITINVALID_CHUNK_SIZE#find_end_of_trailer#find_end_of_chunk_sizechunk_size_line_minchunk_size_line_max #skip_crlf#parse_header_fieldHTTP_Parsers_b25f2386header_field_regex_fexecgroup nextbytesempty_header_field_regex_fobs_fold_header_field_regex_fINVALID_HEADER_FIELD#parse_status_line!status_line_regex_fINVALID_STATUS_LINE#parse_request_line!request_line_regex_fINVALID_REQUEST_LINE##find_end_of_header#1#find_end_of_header#1header_size_limitHEADER_CONTAINS_OBS_FOLD#find_end_of_header#empty_header_field_regex_finit!#obs_fold_header_field_regex_f#header_field_regex_f#status_line_regex_f#request_line_regex_f#init!compile initialize!emptyssprevind#group0/opt/julia/packages/HTTP/sJD5V/src/parseutils.jlPCREovec_ptrUNSET unsafe_load #nextbytes#execregex match_options #initialize!create_match_dataHandlersCookie#25#26#25./opt/julia/packages/HTTP/sJD5V/src/Handlers.jl #getcookies getcookiescookiesCookies#23#24handler#cookie_middlewarecookie_middleware #getparamgetparam getparams #getparamsparams #getroutegetrouteroute #gethandler gethandlerroutesParamsLeaf variables keepemptyVariablepatternNodesegmentexact conditionalwildcard doublestarRouter_404_405 middleware #register! register!insert! #default405 default405 #default404 default404coalescemissing#19#22#19#18#21#17#20#17#matchfindbysort!#11#16#10#15#9#14#8#13#8#7#12#insert!HTTP_Handlers_3f407269identity##find#6#find#6#find#segment isvariable startswith #isvariableVARREGEX ##serve!#5 #serve!#5 streamhandler#serve!serve! ##serve#4#serve#4#serveserve##RequestHandlerFunction#3#RequestHandlerFunction#3RequestHandlerFunction#RequestHandlerFunction#streamhandlerHandler Middleware StreamRequest #readbody! readbody!@/opt/julia/packages/HTTP/sJD5V/src/clientlayers/StreamRequest.jl BufferStreamGenericIOBuffermaxsizeGzipDecompressorStreamgzstream #readbodyreadbody #writechunk writechunkwritebodystream#writebodystream #writebody writebodynbytes_written streamlayer#3#5H/opt/julia/packages/ConcurrentUtilities/J6iMP/src/ConcurrentUtilities.jlHTTP_StreamRequest_8374fe88 decompressreqread_duration_ms read_startHTTP_StreamRequest_5007d8cf#2#4write_duration_ms write_startHTTP_StreamRequest_b382739c##streamlayer#1#streamlayer#1HTTP_StreamRequest_7edf65efHTTP_StreamRequest_c669c8f1HTTP_StreamRequest_2dec27e3HTTP_StreamRequest_589a5ab3ChannelInf threadpoolsync_end io_errorsHTTP_StreamRequest_24e14434HTTP_StreamRequest_21d4b392HTTP_StreamRequest_7e068580typelogtag #streamlayer@sync@samethreadpool_spawnConnectionRequest#connect_tunnelconnect_tunnelD/opt/julia/packages/HTTP/sJD5V/src/clientlayers/ConnectionRequest.jl hoststringHTTP_ConnectionRequest_8f0cc625#err#8err#tls_socket_typetls_socket_type #sockettype sockettypeschemeconnectionlayerCompositeException unescapeuri#connections#4#connections#1getproxyCLOSE_IMMEDIATELY#connections#1#5 connections#1BoxcontentsuserinfoHTTP_ConnectionRequest_e6259ad4HTTP_ConnectionRequest_be83801econnect_errorsconnect_duration_ms#2#6#3#7 exceptionsunwrap_exception_to_rootHTTP_ConnectionRequest_c5749ea3has_wrapped_exceptionHTTP_ConnectionRequest_95b0143dHTTP_ConnectionRequest_415ee827 logerrors target_url#connectionlayer #getproxy isnoproxy islocalhostNO_PROXY_getenvjl_cstr_to_string_collect jl_string_ptroffsetmemcmp _nextind_strthisindjl_pchar_to_stringenv.jl_hasenv access_env #split#487 eachsplit#eachsplit#483 SplitIterator_memcmpcmem.jlminimummaximum__inbounds_setindex! #isnoproxy hasdotsuffix #hasdotsuffix #islocalhost RetryRequest IOContext#no_retry_reasonno_retry_reason?/opt/julia/packages/HTTP/sJD5V/src/clientlayers/RetryRequest.jlunwrap_exception isrecoverable #_retry_check _retry_checkis_wrapped_exception#isrecoverable UV_EAI_AGAINmsg retrylayerExponentialBackOff#manageretries#3 manageretriesFALSE#manageretries#1nfactor#manageretries#1#4manageretries#1 retryattemptHTTP_RetryRequest_d728ac44#2#5retrydelayscheck retry_checkretriesHTTP_RetryRequest_d8b6218areq_body_is_markedHTTP_RetryRequest_744ca202HTTP_RetryRequest_e6f65c3c #retrylayer#FALSEExceptionRequestexceptionlayer #exceptions#2C/opt/julia/packages/HTTP/sJD5V/src/clientlayers/ExceptionRequest.jl #exceptions#1#exceptions#1#3 exceptions#1 status_errorstimedout#exceptionlayerTimeoutRequest timeoutlayer #timeouts#3timeoutsA/opt/julia/packages/HTTP/sJD5V/src/clientlayers/TimeoutRequest.jl #timeouts#1 #timeouts#1#4 timeouts#1TimeoutExceptiontimeout_errorsHTTP_TimeoutRequest_c5e6d1a5timeout #timeoutlayer CookieRequest cookielayer stringify#managecookies#4 managecookies@/opt/julia/packages/HTTP/sJD5V/src/clientlayers/CookieRequest.jl#managecookies#1 COOKIEJAR#managecookies#1#5managecookies#1 getcookies!includedCookies setcookies!SameSitevaluedomainexpires rawexpirescreation lastaccessmaxagesecurehttponly persistenthostonlysamesiterawunparsed CookieJarentriespreviouslyincluded #cookielayerHeadersRequest#setuseragent! setuseragent!A/opt/julia/packages/HTTP/sJD5V/src/clientlayers/HeadersRequest.jl USER_AGENT#canonicalizeheaderscanonicalizeheaders headerslayer#defaultheaders#2defaultheaders#defaultheaders#1#defaultheaders#1#3defaultheaders#1HTTP_HeadersRequest_7f90c858HTTP_HeadersRequest_e6651461 iofunction #headerslayerRedirectRequest #newmethod newmethodB/opt/julia/packages/HTTP/sJD5V/src/clientlayers/RedirectRequest.jlsame #verify_url verify_url#isdomainorsubdomainisdomainorsubdomain #nredirects nredirects redirectlayerresolvereferenceSENSITIVE_HEADERS #redirects#3 redirects #redirects#1#redirects#1#4 redirects#1HTTP_RedirectRequest_5b5b8831 responsebodyoldurl#redirectlayerMessageRequest messagelayerCapturedException#makerequest#3 makerequestA/opt/julia/packages/HTTP/sJD5V/src/clientlayers/MessageRequest.jl#makerequest#1#makerequest#1#4 makerequest#1 mkreqheadersextotal_request_duration_msresponse_stream #messagelayer #mkreqheaders#splithostport splithostport//opt/julia/packages/HTTP/sJD5V/src/cookiejar.jlfindlastcontains#domainAndType!domainAndType!isIPchopisasciitail #defaultPath defaultPathcount#hasporthasport#canonicalhost canonicalhost endOfTime#10#11 #setcookies!readsetcookiesnowUTCSecondDateTimeHTTP_Cookies_3304a8ab#8#9 #getcookies!HTTP_Cookies_4b8e84df shouldsendHTTP_Cookies_e13944c7lt #pathmatch pathmatch #domainmatch domainmatch #shouldsend #isurlchar isurlchar-/opt/julia/packages/HTTP/sJD5V/src/cookies.jlnormal_url_char#sanitizeCookiePathsanitizeCookiePathvalidcookiepathbyteChar#sanitizeCookieValuesanitizeCookieValuevalidcookievaluebyte#sanitizeCookieNamesanitizeCookieName#isCookieDomainNameisCookieDomainNameoccursin#validCookieDomainvalidCookieDomain#validCookieExpiresvalidCookieExpiresyear #readcookies readcookiesiscookienamevalidparsecookievalue#cookies#isIPisequal#readsetcookiesSameSiteDefaultModeSameSiteLaxModeSameSiteStrictModeSameSiteNoneModeRFC1123GMTFormatAlternateRFC1123GMTFormate, dd u yyyy HH:MM:SS G\MTe, dd-uuu-yyyy HH:MM:SS G\MT@dateformat_str DateFormat #gmtformat gmtformate, dd-uuu-yyyy HH:MM:SS_stringENGLISHk/cache/build/builder-amdci4-2/julialang/julia-release-1-dot-10/usr/share/julia/stdlib/v1.10/Dates/src/io.jle, dd u yyyy HH:MM:SS#s178#iscookienamevalid#parsecookievalue#validcookievaluebyte#validcookiepathbyte #addcookie! addcookie!ifelserstrip #stringifyformat RFC1123Format#id ##Cookie#3 #Cookie#3 ##Cookie#2 #Cookie#2 setfield! fieldtype ##Cookie#1 #Cookie#1Dates#46#48#46#47#49 socketready#47 wait_close ##openraw#45 #openraw#45#openrawopenraw ##open#44 #request_uri request_uri ##delete#43 #delete#43#deletedelete ##head#42#head#42#head ##patch#41 #patch#41#patchpatch ##post#40#post#40#postpost##put#39#put#39#putput##get#38#get#38#get#@client@client observelayersfunctionstack parameters::hrefa#@remove_linenums!@remove_linenums!remove_linenums! ##request#37 #request#37#request #request#20foldr#30#36#30obs#29#35#29#28#34#28#27#33#27#26#32#26#25#31#stack observelayer STREAM_LAYERSREQUEST_LAYERSinit popfirst!##popfirstlayer!#24#popfirstlayer!#24#popfirstlayer!popfirstlayer!##poplayer!#23 #poplayer!#23 #poplayer! poplayer!##pushfirstlayer!#22#pushfirstlayer!#22#pushfirstlayer!pushfirstlayer!##pushlayer!#21#pushlayer!#21 #pushlayer! pushlayer!Layer ##request#20parse_multipart_formMultiPartParsing4/opt/julia/packages/HTTP/sJD5V/src/parsemultipart.jlcontent_disposition_regexcontent_disposition_flag_regexcontent_disposition_pair_regexcontent_type_regex#parse_multipart_formparse_multipart_body#parse_multipart_bodyfind_multipart_boundariesparse_multipart_chunk lastindex#parse_multipart_chunkfind_header_boundarycontent_disposition_regex_fparsemultipartHTTP_MultiPartParsing_8abb68a0 content_disposition_flag_regex_f content_disposition_pair_regex_fcontent_type_regex_f String(chunk)#content_type_regex_f!#content_disposition_pair_regex_f!#content_disposition_flag_regex_f#content_disposition_regex_f#find_header_boundaryCRLFCRLFbyte_buffers_eq##find_multipart_boundaries#2#find_multipart_boundaries#2find_multipart_boundarystart#find_multipart_boundaries##find_multipart_boundary#1#find_multipart_boundary#1 DASH_BYTECR_BYTELF_BYTE HTAB_BYTE SPACE_BYTE#find_multipart_boundary#byte_buffers_eqSEMICOLON_BYTENaN Millisecondisinf|>/isfinite#11#17./opt/julia/packages/HTTP/sJD5V/src/download.jlhdrs local_pathdetermine_filefile#report_callback#18format_bytes_per_secondformat_seconds format_bytesformat_progress#12#19 update_perioddownloaded_bytes prev_timereport_callback start_time total_bytesdownload HTTP_4c343a30sourcedestprogress time_takentime_remaining average_speed downloaded remainingtotal#format_bytes_per_second#16#format_seconds#15digits#format_bytes#14#format_progress#13 ##download#10 #download#10 HTTP_7a04fd99 #downloadtempnameisdirtempdir#determine_filetry_get_filename_from_headerstry_get_filename_from_requestsafer_joinpathdirname#file_from_target#9file_from_target#try_get_filename_from_requestunescape_string#try_get_filename_from_headersjoinpath DomainError#safer_joinpath#observation#7 observation#observation#6#observation#6#8 observation#6 getrequest #observelayer #getrequestConnectionPoolLibcstrftime#symbol_mappingsymbol_mapping remote_addr remote_port remote_user time_iso8601 iswindows time_localrequest_methodserver_protocolbody_bytes_sentcaptures _replace_ #replace#500httpMetafindnext#logfmt_parser->string_index_errjl_alloc_stringmemmove _parse_stringatom _string_nunsafe_copyto!meta.jl#parse#3isexprgreedycombined_logfmt common_logfmt#_length_assert ##escape#1 #escape#1#escapeEnums.jlenum_argument_errornfieldstoInt8 queryparamsHTTP_WebSockets_1c9d8372HTTP_WebSockets_49e7eaa7 _enum_hashnamemapseek alloc_requestappendHTTP_Connections_3fa2cfceHTTP_Streams_49c821e5 showerrortypemin propertynames instancesgetindexHTTP_Streams_93e3dffe StringVectorHTTP_WebSockets_30dc30a9_fd getpropertyproxy socket_typekeyword argumentsocket_type_tlscloseimmediately copyheaders http_version basicauthdetect_content_typecanonicalize_headersstatus_exception retry_delays cookiejarredirectredirect_limitredirect_methodforwardheadersBACKLOG_DEFAULTIOServerallow_obs_foldconnection_limit check_top_bitF0@ @ @@ @@ 0@ 0@ @@ 0@ 0@ 0@ @ @0@ 0@ @ @ 00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000P @ p@ 00 0 0 0 0 0 0 0 0 @p`P0P@ P000 0 0 0 0 0 0 0 @p`P0p@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0   PP0 0 @  PP0 0 @  P 0 @  PP0 0 @  PP0 0 @ 0 0 0 0 0 0 0 0 0 @p`P@ P@ P0P0P@ @ 0 @p`PP0 P P P PPp0PP@@ P@@ @0@@PPP0 00 0 0 @ @pp@ 0 @0p@ 00 @ p@ 0 @ p@ 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 0 @p`PP0 @Pp@@@@@@PP0PPp@0@0@0PP0 0 0 0 0 0 0 @p`P@ P0@ 0 0 0 0 0 0 0 @p`P0p@PP0P@@P0P@@P0P@0P0P@00   P 0 @ @ @  P 0 @ @ @ 0 0 0 0 @p`PP0pPp@@@@@@PP0PPp@0@0@0PP0 0 0 0 @p`P0`@00 0 0 0 0 @p`P@ P0p0 00  0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 @p`P0@ @ p@  0 0 0 0 0 0 @ p`P0P@ 0 @@@p`P0 @ @@ @ 0 @p`P0 @`@ @ @p`P0p @0@ @ @0@ @ @ @ @@@0 @ @ @@ @ @@@ @ @ @ @ @ @ @P@ @ @ @ @@@ @ @ @ @P@ @ @ @ @@@ @ @ @ @P@ @ @ @ p@ @ 0 0 0 0 @p`P0@P@p`P0p@0P0p@0 @0@ @ @ @ 0 0 @p`P0@P @0@ @ @ @ 0 0 0 0 @p`P0@@@p`P0P@0P0P@0P0P@0 @0@ @ @ @ 0 0 0 @p`P0@@ @0@ @ @ @ 0 0 @p`P0@ 0 0 0 0 0 @p`P0@ 0 0 @ @ 0 0 @0 0 0 0 @p`P0@P @0@ @ @ @ 0 0 0 @p`P0`@ 0 0 0 @ p@ 0 0 0 @p`P0@ 0 0 0 @p`P0p @@@ @p`P0P @0@ @0@ @ @ @ 0 0 0 0 0 0 0 @ p`P0`@ 0 @PPp`P0 @ @P P 0 @@@p`P0 @ @@ @ 0 @p`P0 @@ @p`P0p @0@ @0@ @ @ @ 0 0 0 0 @p`P0@ 0 0 0 0 0 @p`P0`@00 0 0 0 0 @p`P0P@ P0@ 0 0 0 @ p`P0` @ @ 0 0 @ p`P0` @ @ 0 @p`P0P@0P0P@0P0P@0P0 @0@ P0p @0@ 0 0 0 @ @ 0 0 0 0 0 0 0 @p`P0@ 0 0 0 0 0 0 0 @ p`P0`@ 0 0 0 @p`P0@ 0 0 0 0 0 0 0 0 @p`P0@0P0P@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0`@00 0 @p`P0`@ 0 @p`P0P@ @P p@ P @p00 0 0 @p`P@ P0 0   P 0 @ @  P 0 @ 0 0 0 0 !0 0 @p`P0`@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`PPp0P@ @ PP0P@00 0 @p`P0P@ 0 0 00 0 0 0 0 0 @p`P0@0P0P@0P0P@ 0 0 0 @ @00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`PP0 @ P P @ P P ` PPp@0@0@0P0 0 0 0 @p`P0`@00 0 0 @p`P0P@00 0 @p`P0`@00 0 p0 @p@ 0 @p@ 0 0 0 0 0 0 @p`P0P@ 0 0 0 0 @p`P0P@00 0 0 0 @p@ 0 0 @ p@ 0 0 0 0 0 0 @0p@ 00 0 @p`P0P@0P0P@0P0p@0P0`@0P0p@0P0P@0@ p@ 0 @p`P0P@ P0P@ P0P@ P0P@ P0P@ P0P@ 0 0 0 0  0 0 0 00000000000000000000 0000  0 0  000000000  000 0 0 0 0 0 0 0 0 0   P 0 @ 0 @p`P0`@ P0p@ P0p@ 0 0 @ @ @ @P000P 0 0 0 0 0 0 0 0 0 0 @p`P0P@ P0P@ P0P@ P0`@ 0 0 00 00 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 @p`P0`@ @ @ @ @0p@ 00 0 0 0 0 0 0 0 0 0 @p`P0@0P0@0 @@ p@ @ P0P@00   PP0 0 @  P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0p@ 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 @ p`P0`@ 0 @p`P0`@0P0P@00 @ p`P0P@ 0 @p`P0`@0P0P@00 0 @p`P0P@00 @ p`P0`@ 0 @p`P0`@0P0P@00 @ p`P0`@ 0 @p`P0`@@P0P@0P0P@00   P 0 @0@ @  P 0 @0@ @  P 0 @0@ @  P 0 @0@  P 0 @0@0@ @  P 0 @0@ @ 0 0 0 0 0 0 0 0 0 @ p`P0`@ 0 0 @p`P0`@0P0P@00 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 @p`P0`@ 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0`@ 0 0 @p`P0p@ 0 0 0 0 0 0 0 0 0 @p`P0p@ P0p@ P0`@ 0 0 0 0 @p`P0P@ 0 0 0 0 0 @p`P0@00 0 0 @p`P0p@00 0 0 @p`P0P@0@ @ @ @ @` @@ p@ @ @ p@ p@ `P0P@00 0 0 0 0 @p`P0p@00 0 0 0 0 @p`P0p@0P0P@0P0P@00 0 @p`P0@0P0p@00 0 0 0 @p`P0p@0P0P@ 0 0 @p`P0p@0P0@ 0 0 @p`P0`@00 0 @p`P0`@00 0 @p`P0`@00 0 0 @p`P0`@0P0`@0 P0p@0P0P@00 0 0 @p`P0@00 @p`P0`@0P0P@00 0 0 @ p`P0`@ 0 @p`P0P@ 0 0 @p`P0P@0 P0`@0P0P@0P0P@0P0P@00 0 @p`P0P@00 0 @p`P0p@ P0@ 0 @p`P0P@ P0P@ 0 0 0 0 0 @p`P0p@ 0 @p`P0`@ 0 0 0 0 0 @p`P0p@ 0 0 0 0 0 0 @p`P0P@ P0p @ 0 0 @p`P0P@ P0@ P0P@ P0`@ @ 0 @p`P0P@ 0 @p`P0`@ 0 0 @p`P0P@ 0 0 @p`P0P@ 0 0 @p`P0P@ P0`@ 0 @p`P0P@ 0 0 @p`P0P@ 0 0 0 @p`P0`@ P0P@ P0`@ @ P0P@ 0 0 0 @p`P0P@ P0P@ 0 0 @p`P0P@ P0p@ 0 @p`P0P@ 0 0 @p`P0P@ 0 0 @p`P0P@ 0 0 0 0 0 0 0 00 0 0 @p`P0P@ P0@0P0P@ 0 0 0 @p`P0@ 0 0 @p`P0@p0 0 0 0 0 0 0 @p`P0P@ P0P@ 0 @p`P0P@ P0P@ P0P@0P0`@00 0 @p`P0P@ 0 0 0 0 0 @p`P0@ 0 0 0 0 0 @p`P0`@@0 0 0 0 0 0 0 0 0 @p`P0@P0 0 0   P 0 @ @  P 0 @ P 0 @ P  P 0 @ @  P 0 @ @  P 0 @ @  P 0 @ @ @  P 0 @ @  P 0 @  P 0 @  P 0 @  P 0 @ @  P 0 @ @  P 0 @ @  P 0 @ @  P 0 @0@  P 0 @ @  PP0 0 @  P 0 @ @  PP0 0 @  P 0 @0@ @  P 0 @ P 0 @0P  P 0 @  P 0 @  P 0 @  P 0 @  P 0 @ @  P 0 @  P 0 @ @  P 0 @ @ 0 0 0 00 0 00 0 0 0 0 @p`P0`@ 0 0 0 0 00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 P0P@ 0 @p`P0P@@0 0 0 0 0 0 0 0 0 0 @p`P0p@ 0 0 0 0 0 @p`P0`@ 0 0   P 0 @0@ @ @  P 0 @  P 0 @ @  P 0 @0@ @ @  P 0 @ @  P 0 @ @  P 0 @ @  P 0 @ @  PP0 0 @  P 0 @ @  P 0 @ @  P 0 @ @  P 0 @ @  PP0 0 @ 0 0 0 0 0 0 0 0 0 0 @p`P0@ 0 @ @ 0 @ @ 0 0 @ @ 0 0 0 0 0 0 0 0 @p`P@ P00 0 0 0 0 0 0 @p`P0P@ P0` @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 @p`P0`@ 0 0 0 0 0 0 0 @p`P0@ @ 0 0 0 0 @p`P0p@0P0P@ 0 0 0 0 0 0 0 0 0 0 0 @p`P0p@00 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@00 0 0 0 0 @p`P0@ 0 0 0 0 @p`P0@ @ P0@ @ 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0`@ @ P0`@ @ 0 0 0 0 0 0 0 0 @p`P0`@00 0 0 0   P 0 @ @  P 0 @ @ @  P 0 @ @ @  P 0 @ @ @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 @0P0p @0 P0P @0 P0` @0 0 0 0 0 0 @p`P0@ 0 0 0 0 @p`P0p@ 0 0 @p`P0P0 0 0 0 0 @p`P0@00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @00p`P0p@ 0 0 @p`P0@@0 0 0 0 0 0 0 0 0 0 @PPp`P0@ P 0 @p`P0@p0 0 0 0 0 0 0 0 0 0 0 @``p`P0@ ` 0 @``p`P0@ ` 0 @``p`P0@ ` 0 @p`P0@p @@ p@ @ @p`P0P@0 P0`@0 @0@ @ @ @ 0 0 0 @p`PP0` PPp@0@0@0P0 0 0 0 0 0 0 0 0 0 @p`P0`@@@p`P0P@0 P0P@0 @0@ @ @ @ 0 0 @p`P0`@@ @0@ @ @ @ 0 0 0 @p`P0`@@ @0@ @ @ @ 0 0 0 0 0 0 0 0 0 0 @p`P0P@ P0@ P0P@ @ @ @ 0 0 0 0 0 0 @p`P0`@ 0 0 @p`P0p@ 0 0 @p`P0`@ 0 0 @p@ 0 0 0 0 0 0 0 0 @p`P0@ @@@ @P@ @ @ @ @ p@ @ 0 0 0 @p`P0`@ 0   P 0 @@@  P 0 @  P 0 @  P 0 @`@  PP0 0 @  P 0 @  P 0 @0@  P 0 @ @ @ @ @  P 0 @ 0 0 0 0 0 0 0 0 @p`P0@00 0 0 0 @p`P0p@ @ P0`@ @ 0 0 0 @p`P0`@0 @0@ @ @ @ 0 0 @p`P0`@0 @0@ @ @ @ 0 0 @p`P0`@@ @0@ @ @ @ 0 0 0 0 0 0 0 0 0 0 @p`P0@p @0@ @ @ @ 0 0 0 0 0 0 0 @p`P0`@ 0 0 0 0 0 0 @p`P0`@@ @0@ @ @ @ 0 0 0 0 0 0 0 0 0 0 0 @p`P0`@0P0`@00 0 @p`P0P@ 0 00 @p`PP0PPp@0@0@0P 00  00 @p`P0p@0 0 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 @p`P0@ @pp@ p0 0 @p`P0P@0P0P@00 0 @p`P0@0@0@p@ @p@ p@ 00 0 0 @p`P0p@ 0 @p`P0`@ 0 0 0 0 @ p`P0p@ 0 0 @p`P0P@ P0@00 @p`P0P@ P0@00 0 0 0 0 0 0 0 0 @p`P0p@00 0 @p`P0`@ 0 0 0 @p`P0P@ 0 0 @p`P0P@ 0 0 0 0 0 0 0 0 @p`P0 @`@p`P0`@0 @0@ @ @ @ 0 0 0 0 0 0 @ p`P0`@ 0 @p`P0`@@ @p`P0P@0 @0@ @ @ @ 0 0 0 0 0 0 @ p`P0`@ 0 @p`P0`@@ @p`P0P@0 @0@ @ @ @ 0 0 0 0 0 0 0 0 0 0 @@@p`P0 @ @ 0 @p`P0@`@p`P0P@@ P0P@0 P0`@0 @0@ @ @ @ 0 0 0 0 0 0 @p`P0p@ 0 0 @p`P0`@ 0 0 0 @p`P0@0 @p`P0P@ @0@ @ @ @ 0 0 0 0 0 0 0 @p`P0@ 0 0 @p`P0`@ 0 0 0 0 @p`P0`@P0 0 0 0 0 0 0 0 0 @p`P0p@ 0 0 0 0 @p`P0`@ 0 0 0 @P00P0 0 0 0 0 0 @p`P0@00 0   P 0 @ @ @  P 0 @ @  P 0 @  P 0 @ @  PP0 0 @  P 0 @0 @@p@ @0@ @  P 0 @  P 0 @ @  P 0 @ @ p@ @  P 0 @  PP0 0 @  P 0 @ @  P 0 @  P 0 @ @  P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0`@ P0@@P0P@0P0P@00 0 0 @ p@ 0 0 0 @p`P0p@ 0 0 0 0 @p`P0 @`0 0 0 0 0 0 @p`P0P@00 0 0 0 0 0 @p`P0`@ 0 0 0 0 0 0 0 0 0 0 @p`P0p@ 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@`0 0 0 0 0 0 0 0 @p`P0P@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0P@ 0 0 0 0 0 0 0 0 00 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 @ P0P@ P0`@ P0`@ P0P@ 0 @p`P0P@ P0p@ @ P0@ @ P0@ 0 @p`P0P@ P0@ P0@ 0 @p`P0P@ P00@ P0@ 0 0 0 0 0 0 0 0 0 0 0 0 @p`@P0P@ P0P@ P0P@ P0P @ @ @ @ P0P @ @ @ @ P0P@ P0P@ P0`@ 0 0 0 0 @p`P0`@ 0 0 0 0 0   P 0 @ @ @  P 0 @  P 0 @  P 0 @  P 0 @ @ 0 0 @p`P0P@ P0P@ P0P@ 0 0 0 0 0 0 0 0 0 000 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 0 0 @p`P0P@0P0P@00 0 @p`P0P@ 0 0 0 0 0 0 0 0 @p`P0`@ 0 0 @p`P0P@ 0 @p`P0P@ 0 0 @p`P0P@ 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0p@ P0P@ 0 0 0 0 0 @p`P0@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0   P 0 @ @  P 0 @ P 0 P  P 0 @ @  P 0 @  P 0 @  PP0 0 @ 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 @p`P@ P00 0 0 00 0 @p`P0@ 0 0 0 0 @p`P0`@ 0 0 @p`P0p@ 0 0 @p`P0P@0P0P@ 0 0 0 0 0 0 0 0 0 0 @p`P0 @ 0 0 0 0 @p`P0@00 0 0 0 @p`P0@00 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0p@0@p`P0P@ 0 0 0 0 0 @p`P0` @ 0 0 @@ @ @ 0 @p`P0` @ 0 0 @0 @p`P0` @ 0 0 @0 @p`P0` @ 0 0 @0 @p`P0` @ 0 0 0 @0 @p`P0`@ 0 0 0 0   P 0 @  P 0 @ @  P 0 @ @  P 0 @ @  P 0 @  P 0 @  P 0 @  P 0 @  P 0 @  P 0 @  P 0 @ @  P 0 @  P 0 @ @  P 0 @ @  PP0 0 @  P 0 @ 0 0 0 0 0 0 0 0 @0 0 0 0 0 @p`P0@@P0p@00 0 0 0 0 @p`P0p@00 0 0 0 @p`P0p@0P0P@00 0 0 0 0 @p`P0p@ 0 0 0 0 0 0 @ p@ 0 0 0 0 0 0 0 0 0 @p`PPp0P@ @ PP0P@00 0 @p`P0P@ 0 0 00 0 0 @p`P0P@ 0 @p`P0`@ 0 0 0 @ p`P0p@ 0 @p`P0P@ 0 0 @p`P0P@0P0P@00 @p`P0`@ 0 0 @p`P0`@ 0 0 0 @p`P0@0 @0@@@ @ @ @ @0p@ 0@ @ @ @ @ @ p@ p@ @0p@ 0 0 0 0 0 0 0 @p`P0P@0P0@@0 0 @p`P0P@ P0P@ 0 0 @p`P0P@ P0P@ 0 0 0 0 0 0 @p`P0P@ 0 @p`P0P@00 @p`P0P@ 0 @p`P0 @@0 0 0 0 0 0 0 0 0 @p`P0P@ 0 @p`P0P@ 0 @p`P0`@ 0 @p`P0P@00 @p`P0P@ 0 @p`P0 @@0 0 0 0 0 0 0 @p`P0P@@@p`P0P@00 0 0 0 @p`P0`@ 0 0 0 0 @p`P0p@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0`@@ @p`P0P@0 @0@ @ @ @ 0 0 0 0 @p`P0`@@ @p`P0P@0 @0@ @ @ @ 0 0 0 0 0 @p`P0@0 @p`P0P@ @0@ @ @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ p`P0@ 0 @p`P0P@ 0   P 0 @  P 0 @ @  P 0 @ @  P 0 @0@ @  P 0 @  P 0 @  P 0 @ @  P 0 @ @  P 0 @  PP0 0 @  P 0 @ @  P 0 @ 0 0 0 0 0 0 0 0 0 0 0 0 @p0 @p0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 0 0 0 0 0 0 @p`P0 @@0 0 0 0 0 0 0 0 @ p`P0`@ 0 @p`P0@@ 0 0 @p`P0P@0P0P@0 P0P@00 0 0 0 0 0 @p`P0P@0P0`@0 P0P@00 0 0 0 0 @p`P0@00   P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @@@p`P0@ @ 0 @00p`P0@ 0 0 @p`P00@`@p`P0P@ @0@ @ @ @ 0 0 0 0 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 0 0 0 @p`P0@00 0 0 0 0 @p`P0`@00 @p`P0@0 0 0 0 @p`P0p@@0   P 0 @ @  P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ p`P0@ 0 @ p`P0 0 @p @0@ @ @ @ 0 @p`P0P@ 0 @0 p`P0p@ 0 0 @p`P0`@ 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@00 0 0 0 0 0 0 0 @p`P@ P00 0 0 @0 @p`P0`@ 0 0 0 0 @p`P0`@00 0 0 0 @p`P0p@ 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 0 0 0 0 0 0 0 @p`P0@00 0 0 0 @p`P0`@@0 0 0 0 0 0 0 0 0 0 @p`P0`@ P0`@ P0P@ P0`@ P0`@ P0P@ 0   P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ p`P0p @ 0 @ p`P0 @` @0@ @ @ @ 0 @@0p`P0@0@ 0 @p`P0`@ @ 0 0 0 @p`P0P@ 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0   P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 @ p`P0P@ 0 @ p`P0 @P @0@ @ @ @ 0 @p`P0`@ @ 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0   P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ p`P0P@ 0 @ p`P0@@P @0@ @ @ @ 0 @@@p`P0 @ @ 0 @p`P0`@ @ 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0   P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ p`P0`@ 0 @ p`P0@@ @0@ @ @ @ @ @P@ @P@ @@p@ p@ @ @ @ @ @ @ p@ 0 @p`P0P@ 0 @ p`P0`@ 0 @p`P0`@ @ 0 00 0 P0@ 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 @p`P0P@ 0 0 0 0 0 0 @p`P0P@ 0 @p`P0P @ 0   P 0 @ @  P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ p`P0P@ 0 @ p`P0 @` @0@ @ @ @ 0 @p`P0`@ @ 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0 0 0 @p`P0@00 0 0 0 0 @p`P0@ 0 0 0 0 @p`P0`@00 0 0 @p`P0P@ 0   P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P000 0 0 @ p`P0P@ 0 @ p`P00@` @0@ @ @ @ 0 @00p`P0@ 0 0 @p`P0`@ @ 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 00 0   P 0 @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ p`P0`@@ 0 @ p`P0  @p @0@ @ @ @ 0 @@@p`P0 @ @ 0 @p`P0`@ 0 0 0 0 0 0 0 @p`P0P@0P0P@0P0P@00 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0 0 0 0 @p`P0@ 0 @p`P0 @00 0 0 @p`P0`@ 0 0 @p`P0p@ 0 0 0 0 @p`P0@ 0 0 0 0 0 @p`P0P@ 0 @p`P0@00 0 0 0 0 0 0 0 @p`P0`@00 0 @p`P0@0P0`@00 0 0 @p`P0`@00 @p`P0P@00 0 @p`P0`@00 0 0 @p`P0`@@0 0 0 0 @ p`P0`@ 0 0 0 @p`P0`@ 0 0 00 @p`P0`@ 0 0 0 0 0 @p`P0P@ 0 @p`P0@ 0 0 @p`P0`@ P0P@ 0 @p`P0P@ 0 0 0 @p`P0p@ 0 0 @p`P0`@ 0 @p`P0@0P0P@ P0P@00 0 @p`P0`@ P0`@ 0 0 0 0 0 @p`P0P@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@ P0P@ 0 0 @@ @ 0 @ 0 0 0 @p`P@ @ P@ P0 @ @ @ @ 0P @ @ 0 0 0 0 @p`P0`@ 0 0 0 0 @p`P0`@00 0 @p`P0P@ 0 0 0 0 @p`P0P@ 0 0 0 0 0 0 0 0 0 0 @p`P0p@0P0@00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@0P0P@ P0@0P0P@00 @p`P0p@ 0 0 0 0 0 @p`P0p@@ @0@ @ @ @ 0 0 @p`P0P@0 @0@ @ @ @ 0 0 0 0 0 @p`P0P@0 @0@ @ @ @ 0 0   P 0 @0@  P 0 @  P 0 @ @ @  P 0 @  PP0 0 @  P 0 @0@ @  PP0 0 @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`PPp0P@ @ PP0P@00 0 @p`P0P@ 0 0 00 0 0 0 0 0 0 0 0 0 0 0 0 @@@p`P0@ @ 0 @ p`P0@ 0 @p`P0@@ @p`P0P@0 P0P@0 @0@ @ @ @ 0 0 0 0 0 @p`P0`@P @0@ @ @ @ 0 0 @p`P0P@0P0`@00 @p`P0`@0 @p`P0P@ @0@ @ @ @ 0 0 0 0 @p`P0`@0@p`P0P@ @0@ @ @ @ 0 0 0 0 @p`P0`@0 @p`P0P@ @0@ @ @ @ 0 0 0 0 @p`P0`@0 @p`P0P@ @0@ @ @ @ 0 0 0 0 @p`P0`@0 @p`P0P@ @0@ @ @ @ 0 0 0 0 @p`P0`@0 @p`P0P@ @0@ @ @ @ 0 0 0 0 @p`P0 P @ @ P P P p P P P @ P ` @ P P P P P P @ P @ P ` @ @ @ ` @ @ @ P @ @ @ ` @ @ @ P @ @ @ ` @ @ @ P @ @ @ ` @ @ @ P @ @ @ ` @ @ @ P @ @ @ ` @ @ @ P @ @ @@@P0P@00 0 0 @p`PP0PPp@0@0@0P0 0 0 @p`P0`@p@p`P0P@@P0P@0P0P@0P0P@PP0P@@P0P@@P0P@0 @0@ @ @ @ 0 0 0 0 0 0 0 0 0 @ p`P0P@0 0 @ p`P0P@0 0 @ p`P0P@0 0 @ p`P0P@0 0 @ p`P0P@0 0 @ p`P0P@0 0 @p`P0P@ P0P@ P0@0P0P@00 0 @p`P0`@0@p`P0P@ 0 0 0 0 0 @p`P0`@0@p`P0P@ 0 0 0 0 0 @p`P0`@0@p`P0P@ 0 0 0 0 @p`P0`@0@p`P0P@ 0 0 0 0 @p0 0 0 0 0 `0 0 0 P0 0 0 0 @p`P0`@p @0@ @ @ @ 0 0 0 0 0 000 00 0 0 0 0 0 @p`P@ P00 0 0 0 0 0 @p`P0 @ 0 0 0 0 @p`P0p@00 0 0 0 0 0 0 0 0 0 0 0 @p`P0@ 0 0 0 @p`P0p @ 0 0 @0 @p`P0p @ 0 0 @0 @p`P0p @ 0 0 @0 @p`P0p @ 0 0 0 0 @0 0 @p`P0`@ 0 0 0 @p`P0`@@@p`P0P@00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@@@p`P0P@00 0 0 0   P 0 @ @  P 0 @0@  P 0 @ @  P 0 @ @  P 0 @ @  P 0 @ @  P 0 @ @ 0 0 0 0 0 0 0 @p`P0P@@0 0 0 0 0 0 0 0 0 0 0 0 @p`P0P@ P0P@00 0 @p`P0P@ 0 0  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @`Pp`P0@ ` 0 @@ p`P0@ @ 0 @`@p`P0P@ ` 0 @ p`P0`@ 0 @p`P0`@ 0 @p`P0`@ 0 @p`P0P@ 0 @p`P0@P@p`P0P@0P0P@0P0P@ @0@ @ @ @ 0 0 0 0 0 0 0 0 0 0 0 @p`P0@0P0P@00 0 0 0 0 @ p`P0@ 0 @p`P0p@ 0 0 0 @p`P0p @ 0 0 0 0 0 0 0 @p`P0@0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ p`P0P@ 0 @ p`P0@0 @0@ @ @ @ 0 @p`P0`@ 0 0 0 0 @p`P0P@ P0`@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@00 @p`P0@00 0 0 0 0 0 0 0 0 0 0 0 0 @p`P@ P00@0@P@@@ P P P P P P P P P P P P P P P P P @ P P @ P P P @ P P @ P P P P P P P P P P 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P@ P0@ 0   P 0 @  P 0 @0 @ @  P 0 @ @  P 0 @  P 0 @ @  P 0 @ @ @ @  P 0 @  P 0 @  P 0 @  P 0 @  P 0 @  P 0 @ @  P 0 @  P 0 @ @ @  P 0 @ @  P 0 @0@ @ @  P 0 @  P 0 @  P 0 @0@0@ @  P 0 @ @  P 0 @0 @0 @ 0 0 0 0 0 0 0 0 0 0 0 @p`P0P@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`P0@0 @p`P0P@ @0@ @ @ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 @p`PPp0P@ @ PP0P@00 0 @p`P0P@ 0 @0@ 000P @0@ 00000000000000P@00P@00P@00P@ 0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000@0000 @00000@00@ 0P @0@ 0P @ @ 0P @ @ 0P @0@ 0P @ @ 0P @ @ 0 @ @00P @0@ 0000000P @ @ 00P @ @ 00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 0P@00P@00P@0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000P @@0P@0@ 0P @000P@00@0 @ 00P@00@00Pp@ 0@ 0 0P@ 00P@00P @@0P @@0P @00P@00P@0 0P @00P @@0P @@0P@ 0P @@0P@00P@0 0P @@00Pp@@ 0p@ 0Pp`@00P0P@00 0@0 @ 0Pp0Pp0Pp 0P @ @ 0P@00Pp0P@00P@00PpP0P @@0Pp@ 0`@ 0Pp0P @ @ 0Pp00P@00P @@0P @00Pp0P @@0P@0 0P @ @ 0P@ 0P@0 0P @@0Pp@ 0`@ 0P@00Pp`@00P@00P @00P @00Pp@ 0`@ 0P @00Pp0P @00P@00P@ 0Pp0P @ @ 0P @@0P @ @ 0P @@00P @ 0P@00P@00P @@0P @00Pp0P@00P @000P@ 0PpP@ 0P@00P@00Pp0P@00Pp 0P @@0P@00P @00P@@ @ @ @ 0@ 0@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@P@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@P@@@P@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@0@@@@ @0@ @0@@@@0@@0@@@@0@@@@P@0@@@P@0@@@@@@@@@P@0@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@P@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@P@@@@@@@@@@@@@@@@@@PPP@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@P@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@P@0@P@0@P@0@@@@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@P@0@P@0@@@@@@@@0P@0Pp@@0@@@@@@@@@P@0@@P@ @P@ @@P @0PP@0@@@@@@@0P0P@@Pp`@@@@@PP@@@@@@@@@@@@@@@@@@P @ @ P@@@@@@@@@@@@@@@P@@P @ @ @ @0@@@@@@@P @0PP@0@@@@P @ @ @@@P @0@P @0@P@0@@@@@P@ @@Pp`@@@@@P@ @@@@P @0PP@0@@P@0@P@0@@@@@P@0@P@0@P@@@@@@@@@@@@@@@@@@@@P@0@@P @0@@@P@0@@@@@@@@@@@@@@@@@@@@P@ @P@ P@@P@0@P@0@@@@@P@0@P@0@@@@@@@@@@@P@0@@@@@@@@@@@@@@@@@P@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@P @0@P @0P@P @0@P @0@@P@0@@@@@@``@P@ P@PPP` @P @@PPpp@P @ @ @ @0 P@P@`pp@ ppP@ ppppppppppppP@0ppP@ pppppppppppppP@ pppppppppppppppppppppppppppppppppppP @0p p p ppppppppppppppppppppppppp pPppppppppppppppppppppppppppp0P@ 0P@ 0`@ 0`@ 0p@ 0p@ 0@00P@00P@00P@00PP00@ 0PP00@ 0PP00@ 0P @ @ 0P@ 0`@00p@00p@ 0P@00P@00P@00@00P @ @ 0p@ 0`@ 0P @ @ 0`@ 0@00`@00P@ 0`@00P@ 0P@ 0@ 0`@ @ 00@ @ 0p@00`@00`@00p @0@ 0`@00P@ 0@@ 0@@ 0@@ 0P@ 0P@ 0P@ 0P@00P@00P@00`@00`@00P@@ 0P@0@ 0P@0@ 0P@@@ 0`@00@@ 0@00P@00P@00P@00@@00`@ 0p@ 0@ 0P @ @ 0`@ 0@ 0P@ 0P@ 0P@ 0P@ 0P@ 0P@ 0P@ 0P@ 0P@ 0P@00@00P@ 0P@00P @0@ 0P @ @ 0`@00`@00`@00`@ 0`@ 0`@ 0p @ @ 0P@ 0@ 0P@ 0@ 0@@ 0P@ 0@00P@00@00P@00`@00@00 @0@ 0 @00`@00@00@00p@00`@00`@00P@00@00P@00 @000@P0P@000@000@000 @00 @000@00p @00@000@@0P@@ 0P@00P@00p@00`@00P@0 0P@00P@@ 0@@@0P@0 00 @@@ @ 0p@@00@@0P@@ 0P@P 0 @@0 @@0p@00p@@ 0P@0 0P@00P@@0`@@0P@@ 0P@@ 0P@@ 00@00P@0 0p @@@ 0P@0 0p @@0P@@0P@@0P@@ 0P@0 0p@00p@000@@0@ @@@ 0p @@0P@0 0p@@ 0P@0 0P@@0P@@00@P0P@@0P@P0P@P0p @`0P@@ 0P@@0`@@0 @P0 @P0p @@0P@00p @@0p@00P@00P@00P@@0P@@0P@@0P@@00@P0`@00P@@0 @@0@ @ 0@ 0P@@ @ @ 0P @@ 0P@ 0`@00P@0 0P@ 0P@ 0P@@ @ @0 0P @@ 0`@ 0P@ 0P@00P@00P@P @ @ 0P @P 0P @0 0P@@ @ @ 0P @@ 0P@@ @ @ 0P @@ 0P @0 0P @0 0P @@ 0P @@ 0P@ @ @ 0P @ 0P @P 0p @P 0P@ 0P@ 0P@ 0P@00P@00P@ 0P@ 0P@00P@00P@@ 0P@@0P@@0P@@0P@@0P@ 0P@ 0P@ 0P@00@@ 0@ 0P@P0P@P0P@ 0`@ 0P@@0P@ 0`@ 0`@00P@ 0`@00P@@ 0P@00`@00P@@0P@0 0P@00@ 0P@` 0P@`0P@ 0P@00P@00p@@0P@p0`@ 0P@00`@00P@p0P@00P@ 0P@ 0P@0P@0P@ 0P@ 0P@00P@00P@@0P@ 0P@ 0P@ 0P@00P@00P@@0P@@0P@ 0`@ 0P@ 0P@P 0P@P0P@ 0P@ 0PPp@ @ 0P@00P0PPpP@0PpP@0@00P@00P@@0P@@0P@00P@00P@ 0`@0`  0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000H (0 8(  (((  ((8  @000   @008(((((((((8  @000     (  (      0xH (@8H@08H80 (@8H@08H80 @8`8`80 (@8H@08H80 (@8H@08H80         ((8X(      @00800((8 @ @000000 08@0 @0 00  (   (((0  (0  (0  (0 ((8  @000  @000((8  @0008((( ((8 @ @00@ 0000 @ @00 0000 (      ((8H    @000( (( ((8  @000  @000  @000  @000  @000 0H @8`8`8000 @8`8`8000    ((8 @ @00 0000 @ @00 0000 ((( ((8  @000     ((8P 0  @00  ((8  @000  @000((8  @0008 (((8  @0000 (0 ((((0 (8  @000 0 (8  @0008((8  @00080((8  @0008080000    800   00  00 000   00  000   00  000(0 ((8  @000((8  @000  @00080000((8  @00080000 ((8  @000((8  @000  @000  @00080000((8  @00080000((8  @000 ((((8  @00   (X(( ((8  @00080000((8  @000  (0   ((8  @000(((8  @0008((8  @000880000(((0 (8  @0000 (8  @00080 (8  @0008((8  @0000((8  @000080000 ((8  @000  (((8  @000(((((8  @000  @000(0 (8  @0008( (8  @000 ((8  @000  @000  @000  @0000  @0000 8  (    (((8  @000 ((((0 (8  @000  (((8  @000 (( ( ((8  @000  @000(((((( ((( ((( (    ((    (((((8  @000 (((8  @000((8  @0000 (0 ((8 ( ((8 0  @00 H( x@8`8`800 (@8`8`80    P (((8  @000((8P  0 @000    @000((8  @0008 (( ((((8  @000  @000  @000   (0 ((8 @ @0000000000 0000 ((8  @000(((8  @000((8  @0000((0((0 (((((((8  @000((8  @000  ((0 ( (0 ((((  (0 (((8  @000  @000  @000  @000  @000  @000 (0 ((8  @00   @00   @00   @000  @000  @00000000000000000000000000000000((((((((  X (@8`8`80((8  @00   @000  @000  ( (@008   (((((((8  @00   @000  @000  @00008    ((8  @000  @000((8  @0008((((8  @00   00(0 ((((  (((((8  @00   @0000 (0   @000 0H (@8H@08H80 x@8`8`800    ((((((((( ((((((((8  @000  (( (((((((( ((((( (((8  @000(((      ((8  @000  @000((8  @0008(((0(8  @000((8  @000  @0000 (8  @000((8  @000  @000 (((8  @0000(8  @000((8  @000  @0000(8  @000((8  @000  @000  @000 08h @8`8`8000 @8`8`8000 @8`8`8000 @@8`8`800 @8`8`80000 @8`8`8000    (((((0(8  @000(((8  @000  @000((8  @000  @000((8  @0008 ((((8  @000((((  ( ( ((8  @000((8  @000(  ((((((8  @00   @000  @000  ((8  @000(((((8  @000 ((((8  @000 ((((8  @000   00 (0   (0 (0   @000((((8  @000 ((  ((8  @000  @000  @000 (((8  @000  @000 (((((8  @000  @000(((8  @000  @000(((8  @000 (((8  @000 (((8  @000  (((8  @00   @000   @000  @000 ((((8  @000((8  @000  @000 ((0 (8  @000((8  @000(((8  @000   @000  @000  @000  @000 (((8  @000 (((8  @00   @00 ((8  @00   @00 (((((8  @000((8  @000((  ((8  @00 (((( ((8  @000  @000((8  @00   @00   @000  @0008((8  @00 ((8  @00 ((8  @00 ((8  @00 ((8  @00   @000((8  @00 (((8  @00 ((8  @00   @00   @0008  @000((((8  @00   @000(((8  @00   @000((8  @00 ((8  @00 ((8  @00  (((((( (((8  @00   @000  @000 (((8  @00 (((8  @000    ((8  @00   @00 ((8  @00   @00   @000  @000 (((8  @00 ((((((8  @00     ((8  @000(((((( ((8  @000  0( X@8`8`800 0(@8`8`8 @8`8`8 0 x@8`8`800 @8`8`800 @8`8`800 0@8`8`8000 @8`8`800 (@8`8`80 (@8`8`80 (@8`8`80 x@8`8`800 @8`8`800 @8`8`800 8@8`8`800 @8`8`800 x@8`8`800 (@8H@08H80 h@8`8`800 (@8H@08H80 P@8`8`8000 8x@8`8`80@8`8`800 0@8`8`80 0@8`8`80 x@8`8`80 (@8`8`80 @8`8`800 (@8`8`80 x@8`8`800 @8`8`800       (((((8  @000   0(((8  @000  @000((8  @000  @000((8  @000 ((((  ((8  @000 ((((8  @000 0( @8`8`80000 (@8`8`80 @8`8`800 h@8`8`80000 @8`8`800 @8`8`800 @8`8`800 @8`8`800 (@8H@08H80 @@8`8`800 @8`8`800 @8`8`800 @8`8`800 (@8H@08H80          ((8  @000  0  0    0  (    ((80 0  @00 ((((((8  @000  @000         ((8  @000  @000((8  @0008 ((((8  @000(((((((8  @0008( (((8  @000  @000(((((((  (((8  @000(((  ( (((((((8  @000 ((((8  @000 ((((8  @0008  @0008((((((( (((8  @000 (((((    (((((((((( (  ((8  @0008  @0008(  ( (((8  @000 (   X p@8`8`800 0@8`8`8080 0@8`8`8080 0@8`8`80000         ((8  @000  @000((8  @0000  @000  @000  @000  ((((8  @000(( ((8  @000 ((8  @008(((((8  @000((((((((((((((((0 (8  @000 ((8  @000   (((((0(8  @000 ((8  @000     (((((0(8  @000 0(8  @000 0(8  @000 ((8  @0000 (0 ((8  @000   @00080000 ((8 @ @000 0000         ((8  @000((8  @000   @00080000((8  @000 80000 ((8  @000 80000(  (  ((8  @000  @000  @000 00(((((((8  @000((8  @000((8  @000 (0     ((8  @0000   0000 (0 ((((8  @000 08( @@8`8`800 (@8`8`80 (@8`8`80 p@8`8`800 (@8H@08H80 (@8`8`80 @@8`8`800 P@8`8`80 000 (@8`8`80      ((((8  @000  (((8  @0008  @0008(((8  @00080000((8  @00080000((8  @00080000((  ((( ((8  @00080000   ( ((8  @000((( ((8  @00080000    (   ((8  @000  @000((8  @000  (8 @ @00 0000    (8  @000  ((8  @000  @000((8  @0008 (((((8  @00  (0  (((8  @00   @000((8  @00  (0(0(0 (((8  @000((8  @000(((0 (8  @000 ((8  @00   @000((8  @00   @000 ((   (((((8  @000((8  @000(((8  @000((8  @000 (((( ((8  @000((8  @00080000   0(8  @000((8  @000 ((8  @000 80000(0(8  @000((8  @000 ((8  @000 80000 (((((0 (8  @000((8  @000((8  @000  @000  @00080000  ((((8  @000((8  @000 ((8  @000 ((8  @000 80000 ( ((8  @000((8  @00 ((((8  @000(     ((8  @000 (((8  @000  @0 (  08 ((((((8  @000 0 @8`8`80 0 @8`8`800 (@8`8`80 @8`8`800 (@8H@08H80 P@8`8`80((0000 0@8`8`80 x@8`8`800 @8`8`8  (0 0 (@8`8`80 (@8H@08H80 H@8`8`800 0@8`8`80 h@8`8`800 @8`8`800  (( (((((((( ((8  @00   @000  @000  @000( (0 (((8  @000  ((8  @000((( ((8  @000 (((((8  @000    (((((8  @000((  ( ((  ((8  @000(((( (((8  @00           ((8  @00 (      ((8  @000  @000((8  @000   @00   @00   @00   @000((8  @000  @0008  @0008  @000((8  @000  @000  @000((8  @000  @00(0  @000   ( ( (((((8  @000@H  @000  @000  @000 00  @000 00@((  @00   @00   @00   (((8  @000(    H( P@8`8`8000 (@8`8`80 (@8`8`80 (@8`8`80 x@8`8`800  ((8  @000  @000  @000 00   ((8  @000  @000((8  @0008( (((((8  @00   @000 (((8  @00 ((((( ((8  @000(((8  @00 ((8  @00 (((8  @00  (((((( ((8  @00   @000  ((((8  @000(((((((((((((((((   ( (   0HH( @@8`8`800 PH@8`8`80@8`8`80 8@8`8`800 @8`8`80 @8`8`80 (@8H@08H80   ((8  @000  @000((8  @0008    ((8h 0  @00 8(((8  @000  ((8  @000(((8  @000(((8  @000  @000  ((((((8  @00    (((8  @000  ( ((8  @000  ((((((((((  ((8  @000((8  @000 ((8  @00 0@ 00((8  @00 0@((8  @00 0@((8  @00 0@((8  @00 0 @((8  @00 (( 0 (@8`8`80 @8`8`800 8@8`8`800 8@8`8`800 (@8`8`80 (@8`8`80 p@8`8`80 (@8`8`80 (@8`8`80 (@8`8`80 8@8`8`800 (@8`8`80 8@8`8`800 @8`8`800 (@8H@08H80 (@8`8`80        (((((((8  @000  @000 ((((8  @000( ((8  @000  @000   ((8  @00     (0  ((8  0 @000    @000((8  @0008 ((((8  @000((8  @000((0 (8  @000((8  @000((8  @000  @000((8  @000(((8  @000((((8  @0000    00(0 00 00 (0 (0 (0  ((((8  @000  @000 (((8  @00   @000((8  @00   @000((((((8  @000((8  @000((8  @000((8  @000(((((((((8  @000((8  @000((8  @000((8  @000((8  @000((8  @000  (((((8  @000((8  @000((8  @000((((8  @000(   ((( (    ((8  @000 ((8  @000 80000( ((8  @000 ((8  @000 80000 ((8  @000 ((8  @000 80000   (((((  0 (8  @000((8  @000 @ (@8`8`80 x@8`8`800 x@8`8`800 @8`8`8000 (@8`8`80 (@8`8`80 x@8`8`800 x@8`8`800 (@8`8`80 (@8H@08H80 x@8`8`800 (@8`8`80   ((((((8  @000  @000((8  @0008(((((((((((8  @000 ((((((0(8  @000 ((8  @000  ((8  @000  @000  @000 (   ((8  @000  @000  @000 (( ((8  @000  p@8`8`800  ((((((((((((     ((((((((((0(8  @000 0(8  @000 ((8  @000((8  @00080000       ((8  @000  @000((8  @0008 ((((((((8  @000((((((8  @000((8  @000  ((8  @000 p h@8`8`800 x@8`8`800   (((((((((((((((((((((((((((((( (    (0 (8  @0000 (8  @00080000 ((8  @0000 (8  @000((8  @000       ((((((8  @000      ((8 0  @00 @((8  @000((((8  @000( ((8  @000 ((8  @000  @000((8  @0008((((((((((((8  @000 (((((8  @000   (    ((((8  @00   @00   @00   @00   @000  @000  x@8`8`800    ( ((((   ((((((((((0 (8  @0000 (8  @000800000(8  @000 ((8  @0000   ((8  @000 ((8  @000  @000((8  @0008 ( 8 x@8`8`800    (((((( 0 (8  @0000 (8  @00080000((8  @0000((8  @000  @000((8  @0008( X x@8`8`800    (((((((((((   0 (8  @0000 (8  @000800000 (8  @000((8  @0000   ((8  @000  @000((8  @0008( x x@8`8`800    (((((((((((((((( ((0 (8  @0000 (8  @00080000      (0(0 000000(0 ((8  @0000 (8  @000((8  @0000 @08((8  @000  @000((8  @0008(((8  @000     (((8  @000((8  @000 hH x@8`8`800 P@8`8`800   ((( (((((((((((((((((((((( 0 (8  @0000 (8  @00080000((8  @0000  ((8  @000  @000((8  @0008(((((8  @000((( ((8  @00 (((((8  @000  (((8  @000 ( x@8`8`800    (((((((((((  (@08 H8((0 (8  @0000 (8  @000800000 (8  @000((8  @0000   ((8  @000  @000((8  @0008( P x@8`8`800    (((((((((((((((((   0 (8  @000 0 (8  @000800000 (8  @000 ((8  @000 (( ( ((8  @000  @000  @000  ((8  @000  @000((8  @0008(((8  @000((8  @00 ((((8  @000(((8  @000(((8  @000 (((8  @000((8  @00   ((( ((8  @000  ((8  @00   @00   (((8  @000((8  @000((8  @000((8  @000((0 (8  @000   ((8  @000 0((8  @000((((((8  @000((8  @00 (((8  @00   @000((8  @00 (((8  @00 (((8  @000((8  @00   @00   @000((8  @00   @00 ((((((8  @000((((((((((( ((8  @00   @000  ((  ((8H       @0000 00 808(((8  @000(((((8  @000((8  @000((((8  @000 (((((( ((8  @00   @00  (((((  (( (((((((((8  @00   @00   @000  @000((8  @00 (  ((8  @00080000((8  @00080000(((((8  @00080000 `8(( X@8`8`8 0 (@8`8`80 p@8`8`8  0 (@8`8`80 (@8H@08H80 @8`8`8  0 (@8H@08H80             ((8H  0 @000    @000((8  @0008 ((((  ((((((0 (8  @000 0 (8  @000((8  @000((8  @000  @00080000 ((8  @00080000((8  @000  @000((8  @000 ((8  @000 80000((8  @000((8  @00080000((8  @000 ((8  @000 80000((8  @000 ((8  @000 80000((8  @000 ((8  @000 80000((8  @000 ((8  @000 80000((8  @0000000000000000000000000000000000000000000000000000000000000000000000000000000  @000 ((8 @ @00 0000 ((8  @000((8  @000  @000  @000  @000  @000  @000  @00080000(((((((0 (8  @000 0 (8  @000 0 (8  @000 0 (8  @000 0 (8  @000 0 (8  @000 ((8  @00   @000  @000  @000 (((8  @00 ((8  @000(((8  @00 ((8  @000(((8  @000((8  @000((8  @000((8  @000(0    0   0( ((8  @00080000 8 8      ((80 0  @00((( (8  @00 0(( ((8  @000((((((((((((8  @000 ((8  @00 0@((8  @00 0@((8  @00 0@((8  @00 0  H(((8  @000(((8  @000((8  @000(((((((((  ((8  @000((8  @000 0X( @8`8`800 H@8`8`800 H@8`8`800 8@8`8`800 P@8`8`800 x@8`8`800 @8`8`800    (((((8  @000 (  ((8  @000  @000((8  @000     ((((((((((((((((0 (8  @0000 (8  @0000(8  @000 0 (8  @000((8  @000((8  @000((8  @000((8  @000((8  @000  @000  @00080000  (((( ((8  @000  @000((( (8  @000((8  @000(((8  @00 0(((((((8  @000 ((((0 (8  @0000 (8  @00080000((8  @000  ((8  @00   @000   (((8  @000((8  @000 ((((        ((88    @8  00 000000000000000000000000000000000000 00(                ((8P    @000 @H(H @8`8`80 8@8`8`8000 x@8`8`800 (@8`8`80 x@8`8`800 0@8`8`80000 @8`8`80 @8`8`80 @8`8`80 @8`8`80 @8`8`80 x@8`8`800 (@8`8`80 @8`8`8000 0@8`8`80 0 @8`8`80000 @8`8`80 (@8`8`80 @8`8`80000 x@8`8`800 @8`8`8000       ((8  @000   ( ((   ( ((8  @000 ((8  @000 80000  ((((((8H  0 @000    @000((8  @00000000H0000000000000000@ 0@ 0@ 0@ 00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000008000000000H000H000H000H000H000H008000H000000000H0000H00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000080@ 0@ 0@ 000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000H00@  0H000@000000@0000 00 @00080@ 00@00H00H00H00@00@0 0H00H00H 0@ 0H00@00@0 0H000 000 @0000 000 @008080000 00 00 80H000@00 00@ 0@00 000H00 00 @0000 00H000 000@00H00H00 00H00@0 0H000@ 0@0 0H00 00 @0000@00 0000@00H00H00 00 @0000H00 00H00@00@00 00H000H00H000H000H00@00@00H00H00 00@00H000@ 0 0000@00@00 00@00 80H00@00H00@   H0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000@ 0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000@ 000@ 000000000@ 0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000@ 0@ 0@ 0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000@00@000000000 @000 000000000000@000@00@000H00@00000000 @0080 00000000000000000000000000H000000000000000000000H00000000000H00@00000H00000H00H00@000000@000 000000@00000H00@000@00@000000@00@00000000000000000000000@000H0000@000000000000000000000@00@0000@00@000000@00@000000000000@ 00000000000000000@0000000000000000000000000000000000H00H000H00H000@00000000000000000000 0 00000000 000000000  00 0  @      0 0 0 0 0 0 0  @0   @      0 0 0 0 0 0 0   @      0 0 0 0 0 0 0        0               0 0H0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0   0 0 00 0 0 0   0 0 0     0 0 0             P @00  @00  @00  @00  @000 @000 @000 @00  @00  @00  @00@0 H 000 @00@8H 000 @00@0   000 @0008 @000 @000 @000 @00  @000 @000 @000 @000 @0008 @00  @00  @0008 @00  @000 @000 @000 @000 @00  @000 @000 @0008 @00(08 @000 @000 @000 @0000 @000 @00  @000 @000 @000 @000 @000 @000 @00  @00  @00  @00  @00  @00  @00 0 @00 0 @00 0 @000 @00  @00  @00  @00  @000 @00  @00  @000 @000 @0008 @00  @000 @000 @000 @000 @000 @000 @000 @000 @000 @00  @000 @000 @000 @000 @0008 @0008 @000 @000 @000 @00  @000 @000 @0008 @000 @000 @000 @000 @00  @00  @00  @000 @000 @000 @000 @000 @0008 @00 0 @000 @000 @000 @000 @000 @000 @000 @00  @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000  @000 @000  @000 @000  @00080 @000 @000 @000 @000 @000 @000 @000 @000  @000  @000 @000 @000 @000  @000 @000 @000 @000  @0008 @000  @000 @000 @000 @000  @000  @000 @000 @000 @0000 @000 @000  @000  @000  @000 @000 @000 @000 @000 @000 @000 @000  @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @0008 @000 @00008 @000 @000 @000 @000 @000 @000 @00008 @000 @000 @000 @000 @000 @00008 @000 @000 @00008 @000 @00008 @000 @000 @000 @000 @000 @00008 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @000 @00 000 @000 @008 000 0000 @000 @000 @000 @000 @000 @000 @00000{(hHXh CHГX x JJ)KhKKK8MnnnSooM8MxMMMMMPNO}0@:@V`ia8ix$ i t t t Su u `58pMPPQQR0SySxTXȬ;x;PPБ8H8(.;jȆ P @ 0@p`0""""[P\`\p\\\\\ЇhgȚ؜О p Ȧ(pxب(GHHH@IXIIIIIIJJKK `P0`@J@0Nlp 0pp pДPЕP`P0  #@Po|  p p"p$0E0Sm0pvz5OPQ@R@б0p0p0PP0@%.00406 >CZP]\P]^^_ `enpWЋ0@0pLMQPXY0[\ls  % 3 4 Z c } @ @ P `  % / 2 @6 @= ` @ @ @ ` 4 8 p@ T s 0v v w w x x y z | p2 4 6 8 a P @ @ ;S0 `$).57=? M0X`YwPy 0 p 0pp  p P0@ P}@Pp0345`78 :<0?@P&&0:;@MPXab0xz0PP000 0  46`8 : BCEXceir` p` `0P@ ` P` ````0 p p@P`##%&' ()@*,P,`./5`<=>@PABDEGHMNNS@TU@VYZg0h@qq vpvP||@`0`00` p000``@PPp  0!!##((-.1@24P46`6 8p8@;;?DEJ0K@OOpUUWXddphhk@lppr{||p 0PppP`@p@P `p P   !" #$ %& '( )p<=CCEEGHQQSSUUWW^^```dd lpluPu@ww{|~ЅP ppp@м0P p`@`P0` p0`@p   p p@`##P** .p.044P66p88=`=AB FpF`JJSPSWX\\^ _`0adef@gkkmnpqqssww{{`@ p@@`И@P0P`p@`000 p0PP p pPPP PP PP   0 `@@0@##0'' -p- /p/22446688<<0AA FpFPLLO0RV@^bg l@qu z`~@ ЙpP@@  p``0 @p   p@$(- 26=AF KO ZpZpe0ff0mm@oox0yz0{~P`Ж `` p p@`0 ``0@P`    `0!!P%%p//44?`?`FFM@NPSSYY[\@ccfg`llopq0rx0yp0@`0`Pо0`P0P`0  $`$((@*,./4567::@II PpP0RRVPV^^0bbf@gk`km`m`qq`ss0zz ~p~@P0Н@`p00`@`p0`0    `  `  & + / 5 : @@ D I M X Y Z 0[ ] ^ _ ` Pf f j k `p p pu u { | 0 @ P К М  0 0  `  `  ` P p p 0 @  ` 0 0 0 @ `  p  p  p     p   p 0 $ P$ ) ) p- - 0 01 4 4 ; ; = = PB B L @N R Y ^ b g p p r r Pv v  Ё @ Ћ P 0 @ Л P Х   `  p P p P P  P 0 p 0 p  P   " # ' ( @, , p. . 03 3 = P> > @ A pA D @E G J S PS V V Z @[ ^ _ b b d d h `h k 0l p Pp  ` p P P  `  `  ` Ж P p p P Ю P p P P p p 0  ` p   ` 0 p  P " 0' p- 2 = `= ? `? B 0C E PN N U pU Y PY `] ] p_ _ a a f g h i k Pk o p `r s ` p ` P 0 p 0 @ @ P  ` 0   ` @ P  @ `  0        @% % P* * 0 1 2 3 4 05 6 07 8 @9 ; P; = 0? @M M Q Q pZ Z _ 0` `d d h h j j `n n q @t u  p p Ў А @ ` @ @ P @   0 P p P  0 0 P P  p @`,,`0099`>>`@@0DDFL MQ RpVVZZ\p^`mm`qqzz~ @@` `` p0@@`0 P p``@@pP  P  0@P"#$%0((@,, 0p0336`68`8;0<=@>BC0JJMMWYYZ`bbf gjko`oPuuww`0`0`P0`@pp0P pP P`p   p0p!!)P)`,,4`4p77 ?p?BB0JJMM@UUww{P|}`Ћ P p@П 0@P`г е 0p@@@0 pppP`  0 pP #p#&&`..102056P;@D@IMRPZZ`aa`cc0gg@ttzz` p0p@ppКPp0``00P   @"&p+01p59=0BpFKPOpT0Y^ c`g mq{|@ @pP@0 P23 567P9;`>?$&p'(*,-P0`1P2345678:0;<P=@>P?@BPDEIJKpLMOOPQR`T0UpWXYZ[\ ^^`apbPc`defhiPk@lpmnoqrstuv`wxy@{|}~p`P0p0p`pP@v@wz|pЂ P` P @@Ц@ оPPPPPp `@`@ pP0``@ pP0P0`@ pP0   `  @     p  P000`@ pP0`@`@   !!"p""P##0$$%%%`&&@'' (()3P578:P< >@BPDF0IPLpOQpS@U WXZp\0^ `pb@dfPhjlmoPqstwy|~``@PЕ`0 @``ЪPз0@Ppp0P@PP0   `  0@p!@#@%@')+P-/1246p8:<@@@BDpFpHJLNQRTpV`XPZ@\0^``@bdfhjpl`n@p0r t`vy{p}p@P В 0P  `` p  `0@@`@p P` 0  p 0P0 "P$&')P+ -/024p608: <>?A@C0E0GHJLN@PQSUXY`[ ]^``bdeg@ikln`prPt0vwy0{`| ~@` @`}`0d(0~)0)0&U0b0b000"/ #?@?Yhll8z22t7~7D0If$.~b . L B < "t!$&>1::^<`<`<<<Av B BNBBHBB^BBjG}N : 6 2 , ( $                                 | x r l f ` Z T P J D .      0u a@_]p\p$ @prЍ 0Y  @ ` P u&`p к0@P`p е0@P`p а0@P`p Ы0@P`p Ц0@P0 * < 4 $        Е`0_^\@p          _^\pap P0000PP`d P L H X F B > @``H`f`o`i`` ```p`S`+`M``?`R`^`j``G```````````````Z_ ? CRZZ[*[6[``kac ergai^j\kkZm0n2nozss(_/eτ0{?JPP> /n p??pWO/OoP/,?Y?v)O@PD@v ?~/i@ߡ ^`Tov}/ItpQrOKl  p) Vfv&6FVfv%B.n? .@n: ; ?1X Y 1X Y 1UX Y 1X Y1X Y 1UX Y .@n: ; ? .@n: ;? .@n: ;? .@n?1UX Y 1UX Y%B.n? .@n: ; ?1UX Y 1UX Y 1X Y 1X Y 1X Y 1UX Y 1UX Y 1X Y .@n: ; ? .@n: ;?.@n: ;?.@n?kBS 0FnU + \  @ - H  J3 Pj J3 j X   q ! : y  /JD  M 6  *0FnV4F*F}>FHRFWH>6GH\]GQp0fG G GGzG o*G2H. z2HH`RjH^H>HHHHHzH o*H H H !H "Hz $ # 0 0 `     I I % .  ( P 9      I 87I%^BS I IV\]*IF]@BaS pK pKV ?`BS K d  K V*K@BS KC KCVFKABS L LVS uABS `M `MV uB+S @NX @ -  @ -  @NV ?  4@*zN,Hp, H>}N>}NRN{BS O<  OV4O"*O"6B1S @PX 6 6  ]j @PV(*(4P(>0(H`(R(40\R#( p`-f -z^B S T@rT@V*T,^BeS pUd pUVU *UBS V *W |#?2rVVQ >UV 4UVd1*UV8CHV,CR W BS pW# *W |#?2h pW#Vg h >W4Wf1*W:CHW,CRwX@BH S `Y `YVeAB S `Z `ZV uB S @[A j  |R q ! : y  /JD  M 6  @[VY_*X[1c>[*4[R[gH[ 2\[ 2 f gH[!z["p[z `# 0   P[p[% \( 9  @ p[R[hH[ 2\[ 2 fhH[!z["p[z #  0 @ p   [p\% \ ( 0 9 `    \R1\iH1\ 2\<\ 2 f iHE\!zI\"pI\z ` # 0    P N\pj\% \ ( 9   @  p s\R\jH\ 2\\ 2 f jH\!z\"p\z # 0 @p  \p\% \( 09 `  \R\kH\ 2\\ 2 f kH\!z\"p\z `# 0   P\p ]% \( 9  @ p]@B S _; _;V  m@B S ` `V V@BY S a aVHeB S ad Z_    :  @ - 26 aV 4a=4a=F*aH*afb+H\bRbAHb>bbbbzbpbz%b4b4b0` P @!p"#$%0&`'()* +P,-./0@1p234506`789: ;P<=>?@@ApBCDE0F`GHIJ KPLMNOP@QpRSTU0V`WXYZ [P \ ] ^ _!`@BMS {* {*Vj LBS |(*  eX *P6 6 9r << |(V ;>8} <48} *8}bH<} bRE}=RE}f@!>\s}pp!R}@R}f!A\}p!z">\B~ CI~ DI~p*I~oH0" DL~PL~k~>k~Oz`"A\ C Dp*oH" DPAO(iGBxS `d    DH`V D4#F4#x*|*H}>>BR\*ȃ8FGBS d    DHV D4#F4#x*|*H }> > BR \*8F{BS   EV~ *:+4e).BS 6 6  l Vm4*>8#RH**\**@BS PC PCV Ku2S p,@ - j   6 6   U + U +  U + y  /JD /xM    M 9_ PX Ps pV 4"4#H*@#H> H\2R2 AHf zp# p# p# * * 3{4$>HH $$ Z$ % P%4*4*H>0H%Hpfr\t,Rt, A z% p% p&    p  pƌӌӌ֌֌ gg @& p&4  $& &  'P' ' '7.CBG8G pW 'B . o8 p$   ( $P( (  (( ) P)VL~j ~` B̍8̍ p4)>HH)uxS ,@ -  H X   q ! : y  /JD  M 6  *VB4z4zH*zH>HH)4)>0*HR`*4.4.H>.H4*>*Hf+\ z0+p! " z `+# +0 ++  , P,% ,( ,9 ,-  @- p- <'uUS ,@ - j   6 6   U + U +  U + y  /JD /xM    M 9_ PX Ps V@ 4-4-H* .H>9 H\`2R`2 AH`fb zP. p. p. z z ˒4.>H H@@ `// Z/ 0 00L4z4zH>H`0Hf“\ē,Rē, A z0 p0 p0 ؓ ؓ   p  p##&&   1pP1  $1 1  202 `2 2.B8 p 2֔Bٔ .ٔ o8ݔ p$   2 $03 p3  33 4 04V L ~j ~` B8 p4`4>HHMH@uS . .V ,uS < V 3 *͗) 4@ *@@uvS ' 'V=AuS Й ЙV uAu S V uAuc S V u@u S p pV  ,u S eX @ - _ @ -  2 eVw 44|*ʝ,H4, >͝>͝, RP5 R5 \5 f06pmvu"S VX Y_ @ - @ - d BM2VV#}; >/A 4/*/4R24H2b pp6Bf6, f6 \6\6 z7 qG q ql qmq 07L p7e ֟D ֟ ֟l ֟m֟^u#S Р@rР@V *,^u[#S @r@VM*$,Au#S V uGu $S @d    DH@Vw D4#F 4#x *|* H} >>BR\*8F{u$S < V 4ۤ"*ۤ"@u%S PC PCVnK@u{%S C CVK^u%S 0 K0V [*ZW[@uG&S S SVH^u&S + K+V [*[u'S P| mY 6 6 6  P   x  [  }] @ -    , b  P*D  6  PV, >4 *fǪ9 \ǪRǪHǪ z7p7\ت=RتHت  = I Ir t G G>t8 P8 33 889=Ы%?ЫЫ {ثH?$+@H@9@.:(L9 B9 $B9 +8o .V~ /B / .: ~P:^t: j Dj p` o: DRìPHì _ :` ; `; ; ;Vsu)S EA j  |R q ! : y  /JD  M 6 EV*1>F*4FRIHI 2\T 2f<H]! za"paz @<# p<0 << = 0=fp% \`=( =9 == > P>RH 2\ 2f>H! z"pz ># >0 ?P? ? ?p֯% \?( @9 @@p@ @ @߯RH 2\ 2fAH! z "p z @A# pA0 AA B 0Bp*% \`B( B9 BB C PC3REHE 2\P 2fCHY! z]"p]z C# C0 DPD D Dbpw% \D( E9 @EpE E Eu ,S K)  f %.   S2{f6 6  X m *W |i #?2KV6#>F( 40F N4`Fr*FyH:HwHF;R(f*(\*z. (p. <F)jmjv!q)z G)pPG<ֲ*ֲ;G*ݲ 'ݲ=CCi 12CL7CpG ,zG*pH<{+{;@H+ ':CC_ 1/C0CppH ,zH+pH<,;I, ':C>C>_ 1>/Cm0Cp0I ,z`I,pI<{u.S @  E@V*z+4)u/S иr, : X  p+ w~ y  /JD /_ P9 6    am % ;s(5иrV26 #*#8&4I(H'/>'zRB0\U0zc0pc fc g4gI0 r Hr>rz 0J4`J J JJZ K PK Kϻ  po $$ .K0$3 f8O g BK g2VL2L@L `˼! `˼ \j RV 4.jZ4$j f BpL gR,z ,p  f  4L,  H>z L 4Me  0M`MZM M Mq   p¾o ƾƾ . N,$ξ f8 g BPN g*#i7Gu2S d    DHVD4#F 4#x *|* H*} >*>*BR-\1*88F 00DnDnDQDQDQDQDQDQ^n^n^n^n^n^n:DS=DSm=DSm=@SWZ^W\bqcx[7BVy-7]A[ffrfrfrfrfrN[N[N[N[N[N[[uhuhuhuhuhuhuE!u(!!!!!!3E3<3<3<3<3<Y!1b|!1bn!1bn!1bn!1bn!1bn!11A1A1A1A1A1A1ALdd||' ' _ _   ? 3? w 3Nw Ni i   W W     7 &7 o &Ao A\ \w  w O O    //g4g4OOjjGG' '_ '_'BB]]x?x?wwWW55PPk7k7ooO O ((CC^/^y/gygGG66Q'Ql'_l_??ww))DD_W_zW111u1uRwu\wuhPchPchs)0CPns n  &. &. &.LdLdLdLdLdLdLdLdtdDMdtdDMdtdDMdDMdDMdDMdDMdtBFeqeqF}},, ,hPchPchs)0CPns n  &. &. &.LdLdLdLdLdLdLdLdtdDMdtdDMdtdDMdDMdDMdDMdDMdtJVeMlVeQUQUZlVeVFF^F^O^VVnnntSh?Mtw?MShSSShMRththtstMR9RXRVRV#]ffrfrfrfrfrE+(3E+3<+3<+3<+3<+3<+Y+Ebubgbgbgbgbg8E8E8E8E8E8EGyGyGyGyuy3K22=  9 9 9Y"9Y"d",",,3,3'c;;Gc$.$.=;=;GrPcJPSY]brbrbrbrbrSSfinalizerIdDict__init__nextind;julia_collect_2906julia___init___2469UInt64;empty!;fillsize;match;iszerorem;#eachsplit#483checkbounds;SSLContext;_deleteend!axes;unsafe_stringzeros<=;SplitIteratormemcmpnextindcollect_to!julia_gmtformat_2683Array;Int64ReentrantLockReentrantLock;setindex!replace;DateFormat;julia_Lockable_2890japi1_vect_2933julia#1collectstartswithlastindex;max;SSLMethodColonjuliapointer_unsafe_take!Expr;Lockablemaxthreadid;sizevectncodeunits;similar;SplitIterator;threadpoolsizeifelseOpCode_funcname_exprjulia#0printpointer;_similar_shape;Pooljulia_include_2679convertremunsafe_convert<check_top_bitStringExpr!=;fill;isempty;setindex!;julia_#1_2427julia_Ref_2903reinterpret;_similar_shape_hasenvnthreadsprevindisexprUInt64==#replace#500julia_include_2433julia___init___2440inunitrange_last;indexed_iteratejulia_Exact_2822is_top_bit_set;_growend!;escjulia_getindex_2919unsafe_store!;-collect_to_with_first!;splitmemcmp;lastindexprevind;julia___init___2730julia_logfmt_parser_2744Masked;setproperty!;#parse#3toInt64RefValue;GenericCondition;japi1_promote_typeof_2932reinterpretmemmovejulia_include_2510getindexaxes1;print_to_stringenum_argument_errorExact#eachsplit#483;push!;SSLMethod;UnitRangeisexpr;ConnectionStatejulia_Ref_2897julia_enum_argument_error_2867TLSClientMethodunitrange_lastcheck_top_bit;axes#1Dictjulia_SSLContext_2962startswith;nthreads;>=julia_ConnectionState_2862julia_collect_to!_2912getindex;resize!;String;SpinLock;replacememsetincludejapi1_promote_typeof_2928SSLContext__unsafe_string!similarcollect_to_with_first!eachsplitthreadpoolsize;stringtoInt64;fill!;julia_print_to_string_2874japi1_promote_typeof_2922isconditionjulia_Masked_2860<=_string_nmemmove;_array_for_array_for;in;collect;TLSClientMethod;Colon;>=;japi1_promote_typeof_2929japi1_promote_typeof_2931unsafe_convert;writeRefValueeachindexiszero;julia_Exact_2827SameSitebswap;_string_n;__inbounds_setindex!;_nthreads_in_poolparse;japi1_print_to_string_2934operator_precedence;Lockable;empty!matchRefjulia_symbol_mapping_2781gmtformat>>checkbounds_string+operator_precedencejulia_Mask_2834julia_iscondition_2393julia_HTMLSig_2850HTMLSigjulia_#1_2514ifelse;logfmt_parserconvert;cconvert;GenericConditionCookieJar#replace#500;zeros;finalizer;*;eachsplit;Pool;japi1_promote_typeof_2930string;getproperty;length;<;>;eachindex;symbol_mappingunsafe_loadUnitRange;Generatorjulia_#1_2431julia___init___2698iterateGenericIOBuffergetpropertyArrayjulia_SameSite_2838julia_gmtformat_2694ncodeunitsjapi1_promote_typeof_2927+;GenericIOBuffer;lengthInt64;axes1fill!DateFormatMaskpromote_typeof*haskeySubStringsetproperty!parsesizeof;print;>esc;maxthreadid__unsafe_string!;-;SubString;#parse#3;julia_Dict_2885julia_Masked_2858isemptyMaskedunsafe_store!unsafe_copyto!unsafe_copyto!;#split#487;_nthreads_in_pool;julia_OpCode_2844cconvertunsafe_string;julia__iterator_upper_bound_2914_iterator_upper_boundjulia_IdDict_2893julia_CookieJar_2829_hasenv;push!_str_sizehint;_unsafe_take!;_deleteend!;IntrusiveLinkedListjulia_Dict_2954julia_include_2740split;_memcmp;maxjulia__funcname_expr_2383julia_Masked_2854iterate;_growend!japi1__string_2940.sizeof_str_sizehintwrite;resize!is_top_bit_setCookieJar;julia_Dict_2949haskey;access_env;_memcmpjapi1__string_2948julia_Ref_2900==;!=bswap>>;__inbounds_setindex!julia_Dict_2958toUInt64toUInt64;IntrusiveLinkedList;SpinLockmemset;access_env#split#487unsafe_load;indexed_iterate;julia_Generator_2916o0getproperty;0UInt64;>0+;0write;0toUInt64;0print;*0sizeof;.0_deleteend!;$0_growend!;f0string;R0getindex;B0print_to_string0is_top_bit_set;0pointer;z0unsafe_convert;0cconvert;40_str_sizehint;0_unsafe_take!;H0iterate;\0GenericIOBuffer;0check_top_bit;0resize!;80String;0<;0>;0convert;0length;4ob40enum_argument_error*0string;D*0Mask(d40getindex*0Array;yD*0include"E*0promote_typeof"E*0promote_typeof`G*0getproperty;R0getindex;>0<;H0iterate;\0_iterator_upper_bound+5>0#140esc;*0Expr;:*0getproperty;0Int64;0isconditionH0getindex;\0operator_precedence;>0==;z0toInt64;R0!=;p0unsafe_convert;&b*0RefValue;40Ref&P b40IdDict*0Array; *0IntrusiveLinkedList;>0ReentrantLock;R0Lockable;\0LockableH0SpinLock;40GenericCondition; R0CookieJar;*0IntrusiveLinkedList;>0ReentrantLock;\0CookieJarH0SpinLock;40GenericCondition;b D*0vect" E*0promote_typeof \0_deleteend!;*0maxthreadid;0toUInt64;0check_top_bit;R0empty!;f0resize!;0UInt64;>0Int64;0_growend!;0is_top_bit_set;40toInt64;0__init__p0<;z0>;0convert;H0length;0cconvert;D*0HTMLSig#D*0MaskedgD*0Exacti0setindex!;40fill;f0fill!;\0eachindex;0isempty;0iterate;H0axes;0#10==;>0size;p0<;z0>;*0Array;R0axes1;D*0SameSiteXP\0getproperty;0#replace#500;z0String;0string;H0unsafe_string;0==;p0getindex;0replace;R0match;0symbol_mapping0pointer;*0unsafe_convert;kKR0length;H0fill!;f0Dict\0memset;*0Array;>0unsafe_convert;40zeros;kKR0length;H0fill!;f0Dict\0memset;*0Array;>0unsafe_convert;40zeros;;> >0gmtformat*0string;40DateFormat;g 240==;R0isempty;H0iszero;f0SSLContext\0unsafe_convert;>0finalizer;!D*0include3"L0getproperty;0UInt64;R0write;j0+;80-;0toUInt64;0sizeof;H0reinterpret;0is_top_bit_set;>0getindex;*0<=;z0==;t0_string0unsafe_copyto!;V0pointer;.0unsafe_convert;0_string_n;0cconvert;`0rem;0*;40iterate;0check_top_bit;0unsafe_store!;$0memmove;0__unsafe_string!;\0ncodeunits;f0bswap;0>>;0convert;I-*-\0getproperty;f0_unsafe_take!;0UInt64;H0+;0toUInt64;40iterate;R0GenericIOBuffer;0_deleteend!;0check_top_bit;z0resize!;0print_to_string0_growend!;0is_top_bit_set;>0getindex;*0<=;0String;0<;0>;0convert;p0length;0cconvert;Z-L0getproperty;0UInt64;R0write;j0+;80-;0toUInt64;0sizeof;H0reinterpret;0is_top_bit_set;>0getindex;*0<=;z0==;t0_string0unsafe_copyto!;V0pointer;.0unsafe_convert;0_string_n;0cconvert;`0rem;0*;40iterate;0check_top_bit;0unsafe_store!;$0memmove;0__unsafe_string!;\0ncodeunits;f0bswap;0>>;0convert;T5D*0OpCode7540esc;*0Expr;>0_funcname_expr#,6D*0ConnectionState"p6E*0promote_typeof"6E*0promote_typeof"6E*0promote_typeof?7D*0Generatorv70*0getproperty;f0setindex!;\0getindex;p0+;R0<;>0-;H0iterate;z0collect_to!8z*0getproperty;0setindex!;0collect0collect_to_with_first!;p0iterate;R0axes;0similar;z0getindex;H0size;\0<;0Array;>0_similar_shape;0_array_for;&-;b*0RefValue;40Ref&;b*0RefValue;40Ref";E*0promote_typeofk6<KR0length;H0fill!;f0Dict\0memset;*0Array;>0unsafe_convert;40zeros;+=>0#140esc;*0Expr;>D*0includeD>D*0include'>b*0Masked;40Masked>D*0Exact'.?b*0Masked;40Masked?0__inbounds_setindex!;~0convert;V0+;0split;.0lastindex;0#split#487;0_growend!;40in;L0getindex;80<=;$0nextind;0unsafe_string;\0==;0eachsplit;p0access_env;j0pointer;0#eachsplit#483;0startswith;0push!;>0haskey;0collect;`0unsafe_convert;0checkbounds;0iterate;0__init__0SplitIterator;t0String;0<;f0!=;0memcmp;0_memcmp;B0SubString;*0_hasenv;?E\0_deleteend!;*0maxthreadid;0toUInt64;0check_top_bit;R0empty!;f0resize!;0UInt64;>0Int64;0_growend!;0is_top_bit_set;40toInt64;0__init__p0<;z0>;0convert;H0length;0cconvert;lKz0setindex!;f0max;*0_nthreads_in_pool;0getproperty;R0*;40threadpoolsize;p0setproperty!;0TLSClientMethod;0SSLMethod;0__init__0SSLContext;\0ifelse;>0nthreads;0==;0getindex;0IntrusiveLinkedList;0Pool;0ReentrantLock;H0unsafe_load;0SpinLock;0GenericCondition;;P>0gmtformat*0string;40DateFormat; QR0getproperty;0UInt64;0toUInt64;0-;`0indexed_iterate;j0isexpr;L0#parse#3;$0_growend!;0is_top_bit_set;0getindex;40<=;0nextind;z0Colon;0>=;*0Expr;0unsafe_copyto!;0pointer;0unsafe_convert;f0unitrange_last;0_string_n;.0push!;0checkbounds;0isempty;p0UnitRange;0check_top_bit;0memmove;\0prevind;t0logfmt_parserV0parse;>0<;H0>;0convert;80length;B0__inbounds_setindex!;kWKR0length;H0fill!;f0Dict\0memset;*0Array;>0unsafe_convert;40zeros;oobDdyDEEG5:bP b  b D E D#DgDiDXPKK>  2!D3"-*-Z-T5D5,6Dp6E6E6E?7D708z-;b;b;E6<K=>DD>D>b>D.?b??EKP QWK stringsio.jlBase.jlint.jltuple.jliobuffer.jlintfuncs.jlpointer.jlio.jlessentials.jlarray.jlboot.jlstring.jlshow.jloperators.jlnumber.jl 0F E+3~<q<Wf8W2<Q~X*Q y<Jx~f"J~fqJzW8^q<.. etJ  < z. < . v.  < z. < . x.%   z]1 stringsEnums.jlio.jl I 8<F@cH /opt/julia/packages/HTTP/sJD5V/srcWebSockets.jl pK> Q+ array.jlboot.jl K  <o`E /opt/julia/packages/HTTP/sJD5V/srcParsers.jl K 3Q$ promotion.jl L a}\}Q$ promotion.jl `M a}\}V array.jlBase.jlint.jlessentials.jlgenerator.jl @N 7z<<X~.y"!a8 noneboot.jlessentials.jl O ;}"G /opt/julia/packages/HTTP/sJD5V/srcConditions.jlBase.jlpromotion.jlessentials.jloperators.jlshow.jlpointer.jlboot.jlc.jl @P' :9<tX.%J|XefhJ@XJJ~<GhJ9XJt~<GMeXJX t Jy.z< Jy~.{f ee<5W4 refpointer.jlrefvalue.jl T ~<,V, iddict.jlboot.jl pU :<|JD /opt/julia/packages/ConcurrentUtilities/J6iMP/srclockable.jllinked_list.jllocks-mt.jllock.jlcondition.jl V  B78,WP /opt/julia/packages/HTTP/sJD5V/srccookiejar.jllinked_list.jllocks-mt.jllock.jlcondition.jl pW >t<:,bWH  array.jl `Y s=Y~\Q$ promotion.jl `Z a}\} /opt/julia/packages/HTTP/sJD5V/srcParsers.jlthreadingconstructs.jlboot.jlessentials.jlarray.jlint.jloperators.jlnumber.jl @[ J}<.z<wJ <z. ffv. <zf <fwwJ <z. ffv. <zf <fwwJ <z. ffv. <zf <fwwJ <z. ffv. <zf <fwwJ <z. <.v. <zf <fzzzzzz `C /opt/julia/packages/HTTP/sJD5V/srcsniff.jl _  )aC /opt/julia/packages/HTTP/sJD5V/srcsniff.jl ` *\_C /opt/julia/packages/HTTP/sJD5V/srcsniff.jl a   /opt/julia/packages/HTTP/sJD5V/srcstatus_messages.jlboot.jlarray.jlint.jlpromotion.jlabstractarray.jlrange.jloperators.jl a <} J<|ft|f.ttttxX888888888888888888888888888888888888888888888888888888888888888888888888888888?  Enums.jl { =- /opt/julia/packages/HTTP/sJD5V/srcstringsaccess_log.jlpointer.jlstring.jlregex.jlBase.jlessentials.jlpromotion.jlutil.jlsubstring.jlio.jl |: E:J}hhJ1;}<ehJ4d;t<|JgJy^t͒t<|JgJyYJהݑ//nDDA A( ` dict.jlboot.jlpointer.jlessentials.jlcmem.jlarray.jl ` B<|JI<Jt|8o` dict.jlboot.jlpointer.jlessentials.jlcmem.jlarray.jl  B<|JI<Jt|8o /opt/julia/packages/HTTP/sJD5V/srcstrings/cache/build/builder-amdci4-2/julialang/julia-release-1-dot-10/usr/share/julia/stdlib/v1.10/Dates/srccookies.jlsubstring.jlio.jl  7C+) /opt/julia/packages/OpenSSL/hXs2T/srcstringsssl.jlpromotion.jlgcutils.jlpointer.jlbasic.jlnumber.jl  ==8}<~f<D$#E}J.J>}<~.j t([B /opt/julia/packages/HTTP/sJD5V/srcHTTP.jl P 3B stringssubstring.jlint.jltuple.jlessentials.jlpromotion.jlio.jlBase.jlboot.jlstring.jlpointer.jlcmem.jlchar.jlbasic.jlnumber.jlarray.jl p bf|Wf)~.tfzfX|<{ v{t<<t~<WX8Xq<.~J<X < {f|Wf)J~..Xzf~< {.}Jf }X}J~f< }< ~tJi~J{<< <zf 9<J }=q /~XJz. ~<J }>J <{f< }J }.X<8Xq<.~.~  .7 ft stringsio.jlint.jltuple.jliobuffer.jlBase.jlessentials.jlarray.jlboot.jlstring.jloperators.jlnumber.jl  g<|<fJ<Hq<tWXaJJHJq<<JfW%aJXetJ <z. <f v. <z. <f x.' aXzB stringssubstring.jlint.jltuple.jlessentials.jlpromotion.jlio.jlBase.jlboot.jlstring.jlpointer.jlcmem.jlchar.jlbasic.jlnumber.jlarray.jl  bf|Wf)~.tfzfX|<{ v{t<<t~<WX8Xq<.~J<X < {f|Wf)J~..Xzf~< {.}Jf }X}J~f< }< ~tJi~J{<< <zf 9<J }=q /~XJz. ~<J }>J <{f< }J }.X<8Xq<.~.~  .7 ft?  Enums.jl  =Id /opt/julia/packages/HTTP/sJD5V/srcConditions.jlboot.jlessentials.jl   :<)}@s?  Enums.jl  =Y-Q$ promotion.jl Й a}\}Q$ promotion.jl  a}\}Q$ promotion.jl  a}\}?$ generator.jl p V array.jlBase.jlint.jlessentials.jlgenerator.jl  Gy<1<JJx. <s /J|.Jx. |XJyt<Jx.s/JJx.<xu array.jlBase.jlint.jlessentials.jlgenerator.jlboot.jlabstractarray.jl  <y<<J<xfs/<x0J|f|.xt8W4 refpointer.jlrefvalue.jl Р ~<,W4 refpointer.jlrefvalue.jl  ~<,Q$ promotion.jl  a}\}` dict.jlboot.jlpointer.jlessentials.jlcmem.jlarray.jl @ B<|JI<Jt|8oa8 noneboot.jlessentials.jl  ;}"G`E /opt/julia/packages/HTTP/sJD5V/srccookies.jl P 3bI /opt/julia/packages/HTTP/sJD5V/srcStatusCodes.jl  3bC /opt/julia/packages/HTTP/sJD5V/srcsniff.jl 0 '7W`C /opt/julia/packages/HTTP/sJD5V/srcsniff.jl  7`C /opt/julia/packages/HTTP/sJD5V/srcsniff.jl  7 /opt/julia/packages/HTTP/sJD5V/src/clientlayersstringsConnectionRequest.jlenv.jlpromotion.jlstring.jlutil.jlarray.jlint.jlessentials.jlpointer.jlcmem.jlsubstring.jlbasic.jlabstractdict.jloperators.jlc.jl P a"<.|<#f|<f~>Xxf <s Jsjfj<  ~|.Af J+|Jef J(y |J) Rt |<|JgRwJ{"Jx. <sJ <Xf{XJx.2 E ~PQ /opt/julia/packages/HTTP/sJD5V/srcparsemultipart.jlthreadingconstructs.jlboot.jlessentials.jlarray.jlint.jloperators.jlnumber.jl  J~<.z<wJ <z. ffv. <zf <fwwJ <z. ffv. <zf <fwwJ <z. ffv. <zf <fwwJ <z. <.v. <zf <fyzzzz q /opt/julia/packages/HTTP/sJD5V/src/opt/julia/packages/OpenSSL/hXs2T/src/opt/julia/packages/ConcurrentUtilities/J6iMP/srcConnections.jlthreadingconstructs.jlpointer.jlint.jlessentials.jlBase.jlssl.jlpromotion.jllinked_list.jllocks-mt.jllock.jlpools.jldeprecated.jlrefvalue.jlcondition.jl " D<=+<aJ{J2|<f< W%J bt= 2 7 v^VUW%J bt: / 0 vHVUW%J bt: / 0 vHVUfW-ȞȞt /opt/julia/packages/HTTP/sJD5V/srcstrings/cache/build/builder-amdci4-2/julialang/julia-release-1-dot-10/usr/share/julia/stdlib/v1.10/Dates/srccookies.jlsubstring.jlio.jl @ 7C+)N  /opt/julia/packages/HTTP/sJD5V/srcstringsaccess_log.jlboot.jlint.jlBase.jlbasic.jlrange.jlstring.jlpointer.jlcmem.jlarray.jlessentials.jlmeta.jltuple.jlexpr.jloperators.jlnumber.jl и" P<~8J|<Xf4LS(<|gY*f\fzf.J<}<|ft}f}Jfg}f}f <{f?~ _X  w Jy2  ~,JZ&t <~f3J&L%J RwJx8 xzJJ<}J<1f}<f}J~fg} {f5~ _J  w Jw(Jz~i yt hRf|e` dict.jlboot.jlpointer.jlessentials.jlcmem.jlarray.jl  B<|JI<Jt|8oLinker: LLD 15.0.7  0 # @ 2 P ? `  0Fn.@,JP,aH,{X@P,,0,w I`,h,p,x,= pJC J pK K + K<? KCc, @L< L,, `M @N NQ PO< O,,,R @P0,P,X,h,>`,O@, PTY T@ T<$ 0U<B pUT, V,, ,4  0W<T  pW#i  X  `Y ,  `Z ,5  @[I , , , ,  ^<  P^<4  ^X ,{  _; ,  _  `  a  0a  a ,E (,V 0,g 8,x @, H, P, X, `, , ,p,x, ,1,S,d,u,,,,,,,,,,8,@,H,P,X,`, h,p,b {*v,, {, `|F |<: |(THv,,, `,-,,,,N ,(,,,,,,7,H,j,,,h,4 <N `, p< ,4 <T i,p,, ,),,   ^',Z PC~ < K | 0I  I9 ,a ЉIs(,,,,2,],,,,,!,I,r,,,, ,(,0,H8,s  |X,,,, ,&,=,],,,,,,,,E,o ,(,8,H,p, x,, ,L ,t , , , , !,8!,I!,k! ,!h,!p,!x,'",Z",",",",!#,P#,|#,#,#,$,C$,v$,$,$,%,4%,t%,% ,%(,%0,3&8,k&@,&H,&P,'X,I'`,'h,',',(,T(,(,(,( ,+)(,f)0,)x,), *,.*,@*,d*,v*,*,*,*,*,*,)+,:+,K+ S+,+,+ + ,+(,+0,,8,F,@,W, b,H,,P,,X,,`,,x,-,9-,^-,-0,-8,-@,-H,.P,.X,'.`,J.h,[. Md.p,~.x,.,.,.,.,/,;/,T/,e/,/ h/,/,/,/ /,0 0 #0 :,0 0;0 J0 \0 n0 L0 P0 TF1 0FnU1,LQ ` n  }  0 ,hL,],,  . ,`, pRp,,S,t  e VH,@,i,z,,,!,f`,, Р@3 @m,*  |D  @~ H, X,a   h, p,  !  CF  0# ,4 , , , , ,  ," (,3 0,D 8,U @,f H,w P, X, `, h, p, x, ,,!,2,C,T,e,v,,,,,,,,B(,,0,A,R,c,t,,,/,@,Q , P% @@,xH,>P,O`,kh,p,,,.,e,X,x,, ,Y,{,,, ,, $,^8,~p ,x , p ,D  p0, ,J A l , , ,,I ,m , , ,X  0 `I0 K0 K1 PK41 Pp1!,1,1 `K1 10,2 +2@,F2P,Y2X,q2 <2 '2,2 2x,3 Й)3 C3 ]3 pr3 3 @<3 P<3 <3 P<3 4 p4 ,D4@,]4 PFq4 PC4 <4 4 S4 4 +4 4 <40,5@,!5 ,5H,?5U5h,t5p,58,5 E5,5,5 PF5 K 6 ,.6,M6,m6,6,6,6 F6(, 7 иr&7,97,L7 ,]7 ,s7 ,7( ,70 ,78 ,7h ,7X ,7` ,7 x7,8,+8@ ,<8P ,j8 P<8 <8 ,8 <8 @8 "8 ,8 ,9!,-90,H98,d9@,{9H,9P,9X,9`,:h,+:p,D:x,j:,:,:,:,:,;,3;,Q;,~;,;,;,;,<,?<,g<,<,<(,<8,<h,=,M=,p=,=,=,=,>,/>,Q>(,>0,>P,>`,>x,?,V?,?,?,?,?,0@,]@,@,@,@,A,EA,rA,A,A,B,.B,bB,B ,B0,C8,8C@,zCH,CP,CX,.D`,uDh,Dp,Ex,HE,zE,E,E,8F,F,F,&G,jG,G, H(,0HP,SH X^HX,H`,Hx,H,H,-I,sI,I,I,I,J,8J,gJ,J,J ,J8, K ,5KH ,cK ,~K ,K ,K K PK K K #L # L #3L pBL, #s8\ !,j!,d0!,0!,LL L t2=|   i   wSd11135QL pLLP(L<'+L H$.dynsym.gnu.version.gnu.version_r.gnu.hash.hash.dynstr.rela.dyn.rela.plt.rodata.eh_frame.text.plt.data.rel.ro.dynamic.got.data.got.plt.bss.debug_abbrev.debug_info.debug_ranges.debug_str.debug_gnu_pubnames.debug_gnu_pubtypes.debug_line.comment.symtab.shstrtab.strtabtext__gnu_h2f_ieee__extendhfsf2__gnu_f2h_ieee__truncsfhf2__truncdfhf2text__gnu_h2f_ieee__extendhfsf2__gnu_f2h_ieee__truncsfhf2__truncdfhf2metadatajl_dispatch_target_idsjl_image_headersysimgjulia_print_to_string_2874SUM.CoreDOT.TupleYY.2876ijl_gc_pool_allocijl_get_nth_field_checkedpjlsys_YY.IOBufferYY.469_46pjlsys_unsafe_write_48pjlsys_YY.stringYY.473_47jlplt_strlen_2884_gotjlplt_ijl_array_grow_end_2458_gotjlplt_ijl_array_del_end_2454_gotjlplt_ijl_array_to_string_2882_gotjl_globalYY.2418ijl_throwjl_symYY.check_top_bitYY.2451pjlsys_throw_inexacterror_4jl_globalYY.2468pjlsys__throw_argerror_15julia_enum_argument_error_2867jl_globalYY.2871jl_globalYY.2872jl_globalYY.2873jl_boxed_uint8_cachejapi1_print_to_string_2934jl_globalYY.2400ijl_apply_genericSUM.CoreDOT.ArgumentErrorYY.2704jfptr_enum_argument_error_2868jl_tls_offsetjl_pgcstack_func_slotjfptr_OpCode_2845julia_OpCode_2844SUM.HTTPDOT.WebSocketsDOT.OpCodeYY.2846julia_Mask_2834julia_getindex_2919SUM.CoreDOT.ArrayYY.2921jlplt_ijl_alloc_array_1d_2518_gotjfptr_getindex_2920julia_include_2433jl_globalYY.2438jl_globalYY.2439jl_f__call_latestjfptr_include_2434japi1_promote_typeof_2928jl_globalYY.2924SUM.HTTPDOT.SniffDOT.ExactYY.2824jl_globalYY.2926japi1_promote_typeof_2922julia__iterator_upper_bound_2914jl_nothingjl_undefref_exceptionjl_globalYY.2911jl_small_typeof_j_str1ijl_type_errorjfptr_collect_toNOT._2913julia_collect_toNOT._2912jfptr_collect_2907julia_collect_2906julia_YY.1_2427jl_symYY.escapeYY.2388jl_f__exprjl_symYY.callYY.2389jl_symYY.isaYY.2429jl_symYY.eYY.2430julia_iscondition_2393jl_globalYY.2402jl_globalYY.2404jl_globalYY.2405jl_falseSUM.CoreDOT.ExprYY.2408jl_globalYY.2420jl_symYY.headYY.2421SUM.CoreDOT.WeakRefYY.2423SUM.MainDOT.BaseDOT.MissingYY.2426jl_symYY.DOT.DOT.DOT.YY.2424pjlsys_EQ.EQ._20jl_symYY.EQ.EQ.YY.2410jlplt_ijl_operator_precedence_2414_gotijl_bounds_error_intsjl_globalYY.2425jfptr_iscondition_2394jl_truejulia_Ref_2903SUM.MainDOT.BaseDOT.RefValueYY.2905jfptr_Ref_2901julia_Ref_2900jfptr_Ref_2898julia_Ref_2897julia_IdDict_2893SUM.CoreDOT.ArrayYY.2895SUM.MainDOT.BaseDOT.IdDictYY.2896julia_Lockable_2890SUM.MainDOT.BaseDOT.IntrusiveLinkedListYY.2493SUM.MainDOT.BaseDOT.ThreadsDOT.SpinLockYY.2495SUM.MainDOT.BaseDOT.ReentrantLockYY.2497_j_const9jfptr_Dict_2886julia_Dict_2885julia_CookieJar_2829jfptr_CookieJar_2830SUM.HTTPDOT.CookiesDOT.CookieJarYY.2831japi1_vect_2933jl_f_tuplejl_globalYY.2776jl_globalYY.2764jl_f__apply_iteratejapi1_promote_typeof_2932SUM.HTTPDOT.SniffDOT.HTMLSigYY.2852julia___init___2440ccall_jl_n_threads_2443_j_str3jl_libjulia_internal_handleijl_load_and_lookupjl_globalYY.2445jl_globalYY.2460jl_globalYY.2462jl_globalYY.2464jl_globalYY.2466jfptr_YY.1_2432julia_YY.1_2431jfptr_include_2511julia_include_2510jfptr_Masked_2859julia_Masked_2858SUM.HTTPDOT.SniffDOT.MaskedYY.2856julia_HTMLSig_2850SUM.MainDOT.BaseDOT.CodeUnitsYY.2826jfptr_HTMLSig_2851julia_Masked_2860julia_Exact_2827jfptr_Exact_2828julia_YY.1_2514SUM.CoreDOT.ArrayYY.2516jl_globalYY.2521jl_globalYY.2523jl_globalYY.2525jl_globalYY.2527jl_globalYY.2529jl_globalYY.2531jl_globalYY.2533jl_globalYY.2535jl_globalYY.2537jl_globalYY.2539jl_globalYY.2541jl_globalYY.2543jl_globalYY.2545jl_globalYY.2547jl_globalYY.2549jl_globalYY.2551jl_globalYY.2553jl_globalYY.2555jl_globalYY.2557jl_globalYY.2559jl_globalYY.2561jl_globalYY.2563jl_globalYY.2565jl_globalYY.2567jl_globalYY.2569jl_globalYY.2571jl_globalYY.2573jl_globalYY.2575jl_globalYY.2577jl_globalYY.2579jl_globalYY.2581jl_globalYY.2583jl_globalYY.2585jl_globalYY.2587jl_globalYY.2589jl_globalYY.2591jl_globalYY.2593jl_globalYY.2595jl_globalYY.2597jl_globalYY.2599jl_globalYY.2601jl_globalYY.2603jl_globalYY.2605jl_globalYY.2607jl_globalYY.2609jl_globalYY.2611jl_globalYY.2613jl_globalYY.2615jl_globalYY.2617jl_globalYY.2619jl_globalYY.2621jl_globalYY.2623jl_globalYY.2625jl_globalYY.2627jl_globalYY.2629jl_globalYY.2631jl_globalYY.2633jl_globalYY.2635jl_globalYY.2637jl_globalYY.2639jl_globalYY.2641jl_globalYY.2643jl_globalYY.2645jl_globalYY.2647jl_globalYY.2649jl_globalYY.2651jl_globalYY.2653jl_globalYY.2655jl_globalYY.2657jl_globalYY.2659jl_globalYY.2661jl_globalYY.2663jl_globalYY.2665jl_globalYY.2667jl_globalYY.2669jl_globalYY.2671jl_globalYY.2673jl_globalYY.2675jl_globalYY.2677julia_SameSite_2838jl_symYY.SameSiteYY.2843pjlsys_enum_argument_error_24jfptr_SameSite_2839SUM.HTTPDOT.CookiesDOT.SameSiteYY.2840jfptr___init___2699julia___init___2698jfptr_gmtformat_2684julia_gmtformat_2683julia_symbol_mapping_2781jlplt_ijl_cstr_to_string_2706_gotjl_globalYY.2784pjlsys_match_10SUM.MainDOT.BaseDOT.SubStringYY.2723jl_globalYY.2789jlplt_ijl_pchar_to_string_2718_got_j_const19pjlsys__replace__11jl_globalYY.2786ijl_copy_astjl_globalYY.2787jl_globalYY.2788jl_symYY.remote_addrYY.2792jl_symYY.remote_portYY.2794jl_symYY.remote_userYY.2796jl_symYY.time_iso8601YY.2797jl_symYY.time_localYY.2799jl_symYY.request_methodYY.2802jl_symYY.requestYY.2801jl_symYY.request_uriYY.2803jl_symYY.server_protocolYY.2804jl_symYY.statusYY.2815jl_symYY.body_bytes_sentYY.2817jl_globalYY.2818jl_globalYY.2790jl_globalYY.2791jl_globalYY.2793jl_globalYY.2795jl_globalYY.2798jl_globalYY.2800jl_globalYY.2805jl_globalYY.2806SUM.CoreDOT.TupleYY.2807jl_globalYY.2808jl_globalYY.2809jl_globalYY.2810jl_globalYY.2811jl_globalYY.2812jl_globalYY.2813SUM.CoreDOT.TupleYY.2814jl_globalYY.2816jl_globalYY.2703pjlsys_ArgumentError_6jl_globalYY.2687jl_globalYY.2820japi1__string_2940pjlsys_error_13jfptr_symbol_mapping_2782julia_Dict_2954SUM.CoreDOT.ArrayYY.2887memsetSUM.CoreDOT.ArrayYY.2951SUM.CoreDOT.ArrayYY.2956SUM.MainDOT.BaseDOT.DictYY.2957_j_const22jfptr_Dict_2955julia_Dict_2949SUM.CoreDOT.ArrayYY.2952SUM.MainDOT.BaseDOT.DictYY.2953jfptr_Dict_2959julia_Dict_2958julia_gmtformat_2694jl_symYY.e2C.SP.ddSP.uSP.yyyySP.HHCOL.MMCOL.SSYY.2697jl_globalYY.2689japi1__string_2948jl_globalYY.2692jl_globalYY.2693pjlsys_DateFormat_26julia_SSLContext_2962libname_SSL_CTX_new_2964MUL.OpenSSL_jllDOT.libsslYY.2479_j_str24ijl_lazy_load_and_lookupSUM.OpenSSLDOT.SSLContextYY.2966jl_globalYY.2969jl_f_finalizerlibname_SSL_CTX_ctrl_2970_j_str25libname_SSL_CTX_load_verify_locations_2971_j_str26SUM.OpenSSLDOT.OpenSSLErrorYY.2483SUM.CoreDOT.AssertionErrorYY.2973jl_globalYY.2974julia_include_2740jl_globalYY.2743jfptr_include_2741jlplt_ijl_array_grow_end_2458ccall_ijl_array_grow_end_2457_j_str5jlplt_ijl_cstr_to_string_2706ccall_ijl_cstr_to_string_2705_j_str12jlplt_ijl_array_to_string_2882ccall_ijl_array_to_string_2881_j_str20jlplt_strlen_2884ccall_strlen_2883_j_str21julia__gnu_h2f_ieeejulia__gnu_f2h_ieeejulia__truncdfhf2MUL.CoreDOT.IntrinsicsDOT.sle_intYY.2709MUL.CoreDOT.IntrinsicsDOT.not_intYY.2409MUL.CoreDOT.CharYY.2941MUL.CoreDOT.IntrinsicsDOT.bswap_intYY.2942MUL.CoreDOT.IntrinsicsDOT.shl_intYY.2943MUL.CoreDOT.IntrinsicsDOT.zext_intYY.2944MUL.CoreDOT.EQ.EQ.EQ.YY.2396MUL.CoreDOT.IntrinsicsDOT.add_intYY.2678MUL.CoreDOT.IntrinsicsDOT.trunc_intYY.2447MUL.CoreDOT.IntrinsicsDOT.eq_intYY.2449MUL.CoreDOT.IntrinsicsDOT.add_ptrYY.2715MUL.CoreDOT.sizeofYY.2712MUL.CoreDOT.SymbolYY.2947MUL.MainDOT.BaseDOT._str_sizehintYY.2936MUL.MainDOT.BaseDOT.IOBufferYY.2877MUL.CoreDOT.nothingYY.2492jl_globalYY.2939MUL.CoreDOT.IntrinsicsDOT.slt_intYY.2455MUL.MainDOT.BaseDOT._throw_argerrorYY.2467_j_str23MUL.MainDOT.BaseDOT.print_to_stringYY.2869MUL.HTTPDOT.WebSocketsDOT.OpCodeYY.2847jl_symYY.OpCodeYY.2849MUL.HTTPDOT.WebSocketsDOT.MaskYY.2837jl_symYY.isdefinedYY.2386jl_symYY.nameofYY.2390MUL.CoreDOT._call_latestYY.2435MUL.HTTPDOT.ParsersDOT.ParsersYY.2437MUL.CoreDOT._apply_iterateYY.2773MUL.MainDOT.BaseDOT.promote_typeofYY.2923SUM.MainDOT.BaseDOT.GeneratorYY.2918MUL.CoreDOT.arrayrefYY.2398MUL.CoreDOT.arraysetYY.2520SUM.CoreDOT.ArrayYY.2908MUL.MainDOT.BaseDOT.collect_toNOT.YY.2909MUL.MainDOT.BaseDOT.firstYY.2401MUL.MainDOT.BaseDOT.NOT.EQ.YY.2403MUL.CoreDOT.ExprYY.2407MUL.CoreDOT.Int64YY.2416SUM.MainDOT.BaseDOT.RefValueYY.2902SUM.MainDOT.BaseDOT.RefValueYY.2899SUM.MainDOT.BaseDOT.DictYY.2889MUL.HTTPDOT.CookiesDOT.CookieJarYY.2833MUL.MainDOT.BaseDOT.getindexYY.2763MUL.HTTPDOT.ParsersDOT.status_line_regexYY.2444MUL.HTTPDOT.ParsersDOT.request_line_regexYY.2459jl_globalYY.2682MUL.HTTPDOT.StatusCodesDOT.StatusCodesYY.2512jl_globalYY.2513MUL.HTTPDOT.SniffDOT.ExactYY.2825MUL.HTTPDOT.StatusCodesDOT.CONTINUEYY.2522MUL.HTTPDOT.StatusCodesDOT.RESET_CONTENTYY.2540MUL.HTTPDOT.StatusCodesDOT.PARTIAL_CONTENTYY.2542MUL.HTTPDOT.StatusCodesDOT.MULTI_STATUSYY.2544MUL.HTTPDOT.StatusCodesDOT.ALREADY_REPORTEDYY.2546MUL.HTTPDOT.StatusCodesDOT.MULTIPLE_CHOICESYY.2550MUL.HTTPDOT.StatusCodesDOT.MOVED_PERMANENTLYYY.2552MUL.HTTPDOT.StatusCodesDOT.MOVED_TEMPORARILYYY.2554MUL.HTTPDOT.StatusCodesDOT.SEE_OTHERYY.2556MUL.HTTPDOT.StatusCodesDOT.NOT_MODIFIEDYY.2558MUL.HTTPDOT.StatusCodesDOT.USE_PROXYYY.2560MUL.HTTPDOT.StatusCodesDOT.TEMPORARY_REDIRECTYY.2562MUL.HTTPDOT.StatusCodesDOT.PERMANENT_REDIRECTYY.2564MUL.HTTPDOT.StatusCodesDOT.BAD_REQUESTYY.2566MUL.HTTPDOT.StatusCodesDOT.UNAUTHORIZEDYY.2568MUL.HTTPDOT.StatusCodesDOT.PAYMENT_REQUIREDYY.2570MUL.HTTPDOT.StatusCodesDOT.FORBIDDENYY.2572MUL.HTTPDOT.StatusCodesDOT.NOT_FOUNDYY.2574MUL.HTTPDOT.StatusCodesDOT.METHOD_NOT_ALLOWEDYY.2576MUL.HTTPDOT.StatusCodesDOT.NOT_ACCEPTABLEYY.2578MUL.HTTPDOT.StatusCodesDOT.PROXY_AUTHENTICATION_REQUIREDYY.2580MUL.HTTPDOT.StatusCodesDOT.CONFLICTYY.2584MUL.HTTPDOT.StatusCodesDOT.GONEYY.2586MUL.HTTPDOT.StatusCodesDOT.LENGTH_REQUIREDYY.2588MUL.HTTPDOT.StatusCodesDOT.REQUEST_ENTITY_TOO_LARGEYY.2592MUL.HTTPDOT.StatusCodesDOT.REQUEST_URI_TOO_LARGEYY.2594MUL.HTTPDOT.StatusCodesDOT.UNSUPPORTED_MEDIA_TYPEYY.2596MUL.HTTPDOT.StatusCodesDOT.REQUESTED_RANGE_NOT_SATISFIABLEYY.2598MUL.HTTPDOT.StatusCodesDOT.EXPECTATION_FAILEDYY.2600MUL.HTTPDOT.StatusCodesDOT.IM_A_TEAPOTYY.2602MUL.HTTPDOT.StatusCodesDOT.MISDIRECTED_REQUESTYY.2604MUL.HTTPDOT.StatusCodesDOT.UNPROCESSABLE_ENTITYYY.2606MUL.HTTPDOT.StatusCodesDOT.NGINX_ERROR_NO_RESPONSEYY.2624MUL.HTTPDOT.StatusCodesDOT.BAD_GATEWAYYY.2640MUL.HTTPDOT.StatusCodesDOT.SERVICE_UNAVAILABLEYY.2642MUL.HTTPDOT.StatusCodesDOT.GATEWAY_TIME_OUTYY.2644MUL.HTTPDOT.StatusCodesDOT.HTTP_VERSION_NOT_SUPPORTEDYY.2646MUL.HTTPDOT.StatusCodesDOT.INSUFFICIENT_STORAGEYY.2650MUL.HTTPDOT.StatusCodesDOT.LOOP_DETECTEDYY.2652MUL.HTTPDOT.StatusCodesDOT.BANDWIDTH_LIMIT_EXCEEDEDYY.2654MUL.HTTPDOT.StatusCodesDOT.NOT_EXTENDEDYY.2656MUL.HTTPDOT.StatusCodesDOT.CLOUDFLARE_SERVER_ERROR_RAILGUN_ERRORYY.2674MUL.HTTPDOT.StatusCodesDOT.SITE_FROZENYY.2676MUL.MainDOT.BaseDOT._getenvYY.2700pjlsys__getenv_38MUL.MainDOT.BaseDOT._collectYY.2708pjlsys_thisind_41pjlsys_SubString_18jl_globalYY.2719SUM.MainDOT.BaseDOT.UnitRangeYY.2724jl_globalYY.2726pjlsys__nextind_str_42MUL.HTTPDOT.MultiPartParsingDOT.content_disposition_regexYY.2732jl_globalYY.2737jl_globalYY.2739_j_str6MUL.HTTPDOT.ConnectionsDOT.default_connection_limitYY.2475jl_globalYY.2477_j_str7MUL.OpenSSLDOT.OpenSSLErrorYY.2482MUL.OpenSSLDOT.SSLMethodYY.2484MUL.MozillaCACerts_jllDOT.MozillaCACerts_jllYY.2486MUL.MozillaCACerts_jllDOT.cacertYY.2488jl_globalYY.2491_j_const10MUL.HTTPDOT.ConnectionsDOT.TCP_POOLYY.2500SUM.ConcurrentUtilitiesDOT.PoolsDOT.PoolYY.2502SUM.ConcurrentUtilitiesDOT.PoolsDOT.PoolYY.2506jl_globalYY.2509MUL.DatesDOT.DateFormatYY.2690MUL.DatesDOT.ENGLISHYY.2691MUL.MainDOT.BaseDOT._replace_YY.2785MUL.HTTPDOT.symbol_mappingYY.2768MUL.MainDOT.BaseDOT.errorYY.2821jl_symYY.printYY.2746MUL.MainDOT.BaseDOT.lastindexYY.2748MUL.MainDOT.BaseDOT.findnextYY.2749pjlsys_findnext_1jl_symYY.httpYY.2751MUL.MainDOT.BaseDOT.isvalidYY.2753pjlsys_isvalid_2_j_str18pjlsys_string_index_err_5MUL.MainDOT.BaseDOT.previndYY.2756MUL.MainDOT.BaseDOT.MetaDOT._parse_stringYY.2759pjlsys__parse_string_9jl_symYY.argsYY.2762MUL.CoreDOT.TupleYY.2770MUL.MainDOT.BaseDOT.pushNOT.YY.2775SUM.CoreDOT.TupleYY.2778jl_globalYY.2780SUM.MainDOT.BaseDOT.DictYY.2961_j_const8MUL.OpenSSLDOT.SSLContextYY.2965MUL.HTTPDOT.HTTPYY.2742ccall_ijl_operator_precedence_2413_j_str4ccall_ijl_alloc_array_1d_2517_j_str11_j_str15_j_str16jl_fvar_idxs_0jl_gvar_idxs_0jl_fvar_offsets_0jl_gvar_offsets_0jl_clone_slots_0jl_clone_idxs_0jl_clone_offsets_0jl_pgcstack_key_slotjlplt_ijl_operator_precedence_2414jlplt_ijl_array_del_end_2454jlplt_ijl_alloc_array_1d_2518jlplt_ijl_pchar_to_string_2718jlplt_memcmp_2728jl_fvar_base_0jl_gvar_base_0jl_f_sizeofccall_ijl_alloc_string_2754memmovejl_globalYY.2937ijl_bounds_error_tuple_intjfptr_print_to_string_2875jfptr_Mask_2835SUM.HTTPDOT.WebSocketsDOT.MaskYY.2836julia__funcname_expr_2383jl_symYY.YY.selfYY.YY.2387jl_symYY.ifYY.2391jl_symYY.nothingYY.2392jfptr__funcname_expr_2384julia_ConnectionState_2862jl_symYY.ConnectionStateYY.2866jfptr_ConnectionState_2863SUM.HTTPDOT.ServersDOT.ConnectionStateYY.2864japi1_promote_typeof_2930japi1_promote_typeof_2929japi1_promote_typeof_2927julia_Generator_2916jfptr_Generator_2917jfptr__iterator_upper_bound_2915ijl_gc_queue_rootjfptr_YY.1_2428jfptr_Ref_2904jfptr_IdDict_2894japi1_promote_typeof_2931jfptr_Lockable_2891SUM.ConcurrentUtilitiesDOT.LockableYY.2892SUM.CoreDOT.ArrayYY.2888jfptr___init___2441julia_include_2679jfptr_include_2680jfptr_Masked_2861julia_Exact_2822jfptr_Exact_2823julia_Masked_2854jfptr_Masked_2855jfptr_YY.1_2515jl_globalYY.2701jl_globalYY.2707_j_const13pjlsys__collect_40jlplt_memcmp_2728_gotSUB.CoreDOT.BoundsErrorYY.2721SUM.CoreDOT.BoundsErrorYY.2722ijl_invokepjlsys_YY.717_39julia___init___2730jl_globalYY.2733jl_globalYY.2735jfptr___init___2731julia___init___2469ccall_jl_n_threads_per_pool_2471libname_TLS_client_method_2478SUM.OpenSSLDOT.SSLMethodYY.2485SUM.ConcurrentUtilitiesDOT.PoolsDOT.PoolYY.2498jl_globalYY.2501jl_globalYY.2505jfptr___init___2470jl_symYY.e2C.SP.ddSUB.uuuSUB.yyyySP.HHCOL.MMCOL.SSYY.2688julia_logfmt_parser_2744jl_symYY.ioYY.2747pjlsys_lastindex_0pjlsys_prevind_7pjlsys__nextind_str_3jl_globalYY.2758pjlsys_String_8jl_symYY.atomYY.2760jl_symYY.errorYY.2761jl_globalYY.2779jl_globalYY.2771jl_globalYY.2777_j_const17jl_symYY.tupleYY.2750jl_symYY.SUB.GT.YY.2752jl_globalYY.2765SUM.MainDOT.BaseDOT.MetaDOT.ParseErrorYY.2767jfptr_logfmt_parser_2745jfptr_Dict_2950SUM.CoreDOT.ArrayYY.2960jfptr_gmtformat_2695jfptr_SSLContext_2963_j_str2ccall_ijl_array_del_end_2453ccall_ijl_pchar_to_string_2717ccall_memcmp_2727MUL.CoreDOT.nfieldsYY.2935MUL.CoreDOT.getfieldYY.2395MUL.CoreDOT.isaYY.2406MUL.CoreDOT.IntrinsicsDOT.bitcastYY.2411MUL.CoreDOT.IntrinsicsDOT.lshr_intYY.2446MUL.CoreDOT.ifelseYY.2474MUL.CoreDOT.UInt64YY.2452MUL.CoreDOT.IntrinsicsDOT.and_intYY.2711MUL.CoreDOT.UInt8YY.2448MUL.CoreDOT.throw_inexacterrorYY.2450MUL.CoreDOT.UIntYY.2481MUL.CoreDOT.IntrinsicsDOT.sub_ptrYY.2716MUL.CoreDOT.IntrinsicsDOT.pointersetYY.2945MUL.CoreDOT.StringYY.2757MUL.CoreDOT.IntrinsicsDOT.mul_intYY.2473MUL.CoreDOT.throwYY.2417MUL.CoreDOT.typeassertYY.2946MUL.MainDOT.BaseDOT.YY.IOBufferYY.469YY.2878MUL.MainDOT.BaseDOT.printYY.2938MUL.CoreDOT.IntrinsicsDOT.arraylenYY.2397MUL.CoreDOT.IntrinsicsDOT.sub_intYY.2456MUL.MainDOT.BaseDOT.stringYY.2399MUL.MainDOT.BaseDOT.YY.stringYY.473YY.2879MUL.MainDOT.BaseDOT.unsafe_writeYY.2880MUL.MainDOT.BaseDOT.CstringYY.2412MUL.CoreDOT.ArgumentErrorYY.2702MUL.MainDOT.BaseDOT.EnumsDOT.enum_argument_errorYY.2842MUL.CoreDOT._exprYY.2385MUL.MainDOT.BaseDOT.includeYY.2436MUL.HTTPDOT.ServersDOT.ConnectionStateYY.2865MUL.MainDOT.BaseDOT.iterateYY.2774MUL.MainDOT.BaseDOT.promote_typeYY.2925MUL.CoreDOT.IntrinsicsDOT.ult_intYY.2710MUL.CoreDOT.arraysizeYY.2519MUL.CoreDOT.IntrinsicsDOT.sext_intYY.2415MUL.MainDOT.BaseDOT.getpropertyYY.2419MUL.MainDOT.BaseDOT.EQ.EQ.YY.2422MUL.MainDOT.BaseDOT.ThreadsDOT.SpinLockYY.2494MUL.MainDOT.BaseDOT.ReentrantLockYY.2496MUL.CoreDOT.tupleYY.2772MUL.CoreDOT.IntrinsicsDOT.cglobalYY.2442MUL.HTTPDOT.ParsersDOT.header_field_regexYY.2461MUL.HTTPDOT.ParsersDOT.obs_fold_header_field_regexYY.2463MUL.HTTPDOT.ParsersDOT.empty_header_field_regexYY.2465MUL.HTTPDOT.CookiesDOT.CookiesYY.2681MUL.HTTPDOT.SniffDOT.MaskedYY.2857MUL.HTTPDOT.SniffDOT.HTMLSigYY.2853MUL.HTTPDOT.StatusCodesDOT.SWITCHING_PROTOCOLSYY.2524MUL.HTTPDOT.StatusCodesDOT.PROCESSINGYY.2526MUL.HTTPDOT.StatusCodesDOT.EARLY_HINTSYY.2528MUL.HTTPDOT.StatusCodesDOT.OKYY.2530MUL.HTTPDOT.StatusCodesDOT.CREATEDYY.2532MUL.HTTPDOT.StatusCodesDOT.ACCEPTEDYY.2534MUL.HTTPDOT.StatusCodesDOT.NON_AUTHORITATIVE_INFORMATIONYY.2536MUL.HTTPDOT.StatusCodesDOT.NO_CONTENTYY.2538MUL.HTTPDOT.StatusCodesDOT.IM_USEDYY.2548MUL.HTTPDOT.StatusCodesDOT.REQUEST_TIME_OUTYY.2582MUL.HTTPDOT.StatusCodesDOT.PRECONDITION_FAILEDYY.2590MUL.HTTPDOT.StatusCodesDOT.LOCKEDYY.2608MUL.HTTPDOT.StatusCodesDOT.FAILED_DEPENDENCYYY.2610MUL.HTTPDOT.StatusCodesDOT.UNORDERED_COLLECTIONYY.2612MUL.HTTPDOT.StatusCodesDOT.UPGRADE_REQUIREDYY.2614MUL.HTTPDOT.StatusCodesDOT.PRECONDITION_REQUIREDYY.2616MUL.HTTPDOT.StatusCodesDOT.TOO_MANY_REQUESTSYY.2618MUL.HTTPDOT.StatusCodesDOT.REQUEST_HEADER_FIELDS_TOO_LARGEYY.2620MUL.HTTPDOT.StatusCodesDOT.LOGIN_TIMEOUTYY.2622MUL.HTTPDOT.StatusCodesDOT.UNAVAILABLE_FOR_LEGAL_REASONSYY.2626MUL.HTTPDOT.StatusCodesDOT.NGINX_ERROR_SSL_CERTIFICATE_ERRORYY.2628MUL.HTTPDOT.StatusCodesDOT.NGINX_ERROR_SSL_CERTIFICATE_REQUIREDYY.2630MUL.HTTPDOT.StatusCodesDOT.NGINX_ERROR_HTTP_TO_HTTPSYY.2632MUL.HTTPDOT.StatusCodesDOT.NGINX_ERROR_OR_ANTIVIRUS_INTERCEPTED_REQUEST_OR_ARCGIS_ERRORYY.2634MUL.HTTPDOT.StatusCodesDOT.INTERNAL_SERVER_ERRORYY.2636MUL.HTTPDOT.StatusCodesDOT.NOT_IMPLEMENTEDYY.2638MUL.HTTPDOT.StatusCodesDOT.VARIANT_ALSO_NEGOTIATESYY.2648MUL.HTTPDOT.StatusCodesDOT.NETWORK_AUTHENTICATION_REQUIREDYY.2658MUL.HTTPDOT.StatusCodesDOT.CLOUDFLARE_SERVER_ERROR_UNKNOWNYY.2660MUL.HTTPDOT.StatusCodesDOT.CLOUDFLARE_SERVER_ERROR_CONNECTION_REFUSEDYY.2662MUL.HTTPDOT.StatusCodesDOT.CLOUDFLARE_SERVER_ERROR_CONNECTION_TIMEOUTYY.2664MUL.HTTPDOT.StatusCodesDOT.CLOUDFLARE_SERVER_ERROR_ORIGIN_SERVER_UNREACHABLEYY.2666MUL.HTTPDOT.StatusCodesDOT.CLOUDFLARE_SERVER_ERROR_A_TIMEOUTYY.2668MUL.HTTPDOT.StatusCodesDOT.CLOUDFLARE_SERVER_ERROR_CONNECTION_FAILEDYY.2670MUL.HTTPDOT.StatusCodesDOT.CLOUDFLARE_SERVER_ERROR_INVALID_SSL_CERITIFICATEYY.2672MUL.HTTPDOT.CookiesDOT.SameSiteYY.2841MUL.MainDOT.BaseDOT.thisindYY.2713_j_const14MUL.HTTPDOT.ConnectionRequestDOT.NO_PROXYYY.2714MUL.CoreDOT.BoundsErrorYY.2720jl_globalYY.2725MUL.MainDOT.BaseDOT._nextind_strYY.2729MUL.HTTPDOT.MultiPartParsingDOT.content_disposition_flag_regexYY.2734MUL.HTTPDOT.MultiPartParsingDOT.content_disposition_pair_regexYY.2736MUL.HTTPDOT.MultiPartParsingDOT.content_type_regexYY.2738MUL.CoreDOT.IntrinsicsDOT.pointerrefYY.2472MUL.CoreDOT.setfieldNOT.YY.2476MUL.MainDOT.BaseDOT.C_NULLYY.2480MUL.CoreDOT.getglobalYY.2487MUL.HTTPDOT.ConnectionsDOT.nosslcontextYY.2490MUL.HTTPDOT.ConnectionsDOT.MBEDTLS_POOLYY.2504MUL.HTTPDOT.ConnectionsDOT.OPENSSL_POOLYY.2508MUL.MainDOT.BaseDOT._stringYY.2685MUL.MainDOT.BaseDOT.matchYY.2783MUL.MainDOT.BaseDOT.string_index_errYY.2755MUL.MainDOT.BaseDOT.MetaDOT.ParseErrorYY.2766MUL.OpenSSLDOT.freeYY.2967MUL.CoreDOT.finalizerYY.2968MUL.CoreDOT.AssertionErrorYY.2972jl_fvar_idxs_1jl_gvar_idxs_1jl_fvar_offsets_1jl_gvar_offsets_1jl_clone_slots_1jl_clone_idxs_1jl_clone_offsets_1jl_fvar_base_1jl_gvar_base_1jl_RTLD_DEFAULT_handle_pointerjl_RTLD_DEFAULT_handlejl_shard_tablesjl_ptls_tablejl_image_pointersjl_system_image_datajl_system_image_size_DYNAMIC H oHHFo@%o,/ 5= GB (Q2YP$P$c0F06i@@n{ȶ@0@@|(+@,+,+++Xj<,N0,,*,,300, H,8C.-'/-L